Overview

  • Product name
    Anti-MEK1 antibody [OTI4E1]
    See all MEK1 primary antibodies
  • Description
    Mouse monoclonal [OTI4E1] to MEK1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Dog, Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Human MEK1 aa 1-393.
    Sequence:

    MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRL EAFLTQKQKVGELKDDDFEK ISELGAGNGGVVFKVSHKPSGLVMARKL IHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEIS ICMEHM DGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNI LVNSRGEIKLCDFG VSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQS DIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVE GDAAETPPRPRT PGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCL IKNPAERA DLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHA AGV


    Database link: NP_002746

  • Positive control
    • WB: HEK293T cells transfected with the pCMV6-ENTRY MEK1 cDNA; COS7 cells transiently transfected by pCMV6-ENTRY MEK1 cDNA; HepG2, HeLa, SVT2, A549, COS7, Jurkat, MDCK, PC12 and MCF7 cell extracts; IHC-P: Human breast adenocarcinoma, Human kidney, Human ovary Adenocarcinoma, Human pancreas, Human endometrium and Human tonsil tissues. ICC/IF: COS7 cells transiently transfected by pCMV6-ENTRY MAP2K1
  • General notes

    The clone number has been updated from 4E1 to OTI4E1, both clone numbers name the same clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab139343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/2000. Predicted molecular weight: 43 kDa.
IHC-P 1/150.
ICC/IF 1/100.

Target

  • Function
    Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in a Thr-Glu-Tyr sequence located in MAP kinases. Activates ERK1 and ERK2 MAP kinases.
  • Tissue specificity
    Widely expressed, with extremely low levels in brain.
  • Involvement in disease
    Defects in MAP2K1 are a cause of cardiofaciocutaneous syndrome (CFC syndrome) [MIM:115150]; also known as cardio-facio-cutaneous syndrome. CFC syndrome is characterized by a distinctive facial appearance, heart defects and mental retardation. Heart defects include pulmonic stenosis, atrial septal defects and hypertrophic cardiomyopathy. Some affected individuals present with ectodermal abnormalities such as sparse, friable hair, hyperkeratotic skin lesions and a generalized ichthyosis-like condition. Typical facial features are similar to Noonan syndrome. They include high forehead with bitemporal constriction, hypoplastic supraorbital ridges, downslanting palpebral fissures, a depressed nasal bridge, and posteriorly angulated ears with prominent helices. The inheritance of CFC syndrome is autosomal dominant.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylation on Ser/Thr by MAP kinase kinase kinases (RAF or MEKK1) regulates positively the kinase activity.
    Acetylation by Yersinia yopJ prevents phosphorylation and activation, thus blocking the MAPK signaling pathway.
  • Information by UniProt
  • Database links
  • Alternative names
    • Dual specificity mitogen activated protein kinase kinase 1 antibody
    • Dual specificity mitogen-activated protein kinase kinase 1 antibody
    • ERK activator kinase 1 antibody
    • MAP kinase kinase 1 antibody
    • MAP kinase/Erk kinase 1 antibody
    • MAP2K1 antibody
    • MAPK/ERK kinase 1 antibody
    • MAPKK 1 antibody
    • MAPKK1 antibody
    • MEK 1 antibody
    • Mek1 antibody
    • MEKK1 antibody
    • Mitogen activated protein kinase kinase 1 antibody
    • MKK 1 antibody
    • MKK1 antibody
    • MP2K1_HUMAN antibody
    • PRKMK1 antibody
    • Protein kinase mitogen activated kinase 1 (MAP kinase kinase 1) antibody
    • Protein kinase mitogen activated, kinase 1 antibody
    see all

Images

  • All lanes : Anti-MEK1 antibody [OTI4E1] (ab139343) at 1/200 dilution

    Lane 1 : HepG2 cell extract (Human).
    Lane 2 : HeLa cell extract (Human).
    Lane 3 : SVT2 cell extract (Mouse).
    Lane 4 : A549 cell extract (Human)
    Lane 5 : COS7 cell extract (Monkey).
    Lane 6 : Jurkat cell extract (Human).
    Lane 7 : MDCK cell extract (Canine).
    Lane 8 : PC12 cell extract (Rat).
    Lane 9 : MCF7 cell extract (Human).

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 43 kDa

  • All lanes : Anti-MEK1 antibody [OTI4E1] (ab139343) at 1/200 dilution

    Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control cDNA.
    Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY MEK1 cDNA.

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 43 kDa

  • All lanes : Anti-MEK1 antibody [OTI4E1] (ab139343) at 1/200 dilution

    Lane 1 : Human testis extract
    Lane 2 : Human uterus extract
    Lane 3 : Human breast extract
    Lane 4 : Human brain extract
    Lane 5 : Human liver extract
    Lane 6 : Human ovary extract
    Lane 7 : Human thyroid gland extract
    Lane 8 : Human colon extract

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 43 kDa

  • immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY MEK cDNA, labelling MEK1 with ab139343 at 1/100 dilution.
  • Immunohistochemical staining of paraffin-embedded Human breast tissue adenocarcinoma labelling MEK1 with ab139343 at 1/150 dilution.
  • Immunohistochemical staining of paraffin-embedded Human Kidney tissue labelling MEK1 with ab139343 at 1/150 dilution.
  • Immunohistochemical staining of paraffin-embedded Human ovary adenocarcinoma tissue labelling MEK1 with ab139343 at 1/150 dilution.
  • Immunohistochemical staining of paraffin-embedded Human pancreas tissue labelling MEK1 with ab139343 at 1/150 dilution.
  • Immunohistochemical staining of paraffin-embedded Human endometrium tissue labelling MEK1 with ab139343 at 1/150 dilution.
  • Immunohistochemical staining of paraffin-embedded Human tonsil labelling MEK1 with ab139343 at 1/150 dilution.

References

ab139343 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up