Overview

  • Product name

  • Description

    Rabbit polyclonal to MEKK3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MEKK3 aa 88-170.
    Sequence:

    NELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVS RQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQ


    Database link: Q99759

  • Positive control

    • U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab219994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Component of a protein kinase signal transduction cascade. Mediates activation of the NF-kappa-B, AP1 and DDIT3 transcriptional regulators.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 OPR domain.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • M3K3_HUMAN antibody
    • MAP/ERK kinase kinase 3 antibody
    • MAP3K3 antibody
    • MAPK/ERK kinase kinase 3 antibody
    • MAPKKK3 antibody
    • MEK kinase 3 antibody
    • MEKK 3 antibody
    • MEKK3 antibody
    • Mitogen activated protein kinase kinase kinase 3 antibody
    • Mitogen-activated protein kinase kinase kinase 3 antibody
    see all

Images

  • Immunofluorescent analysis of U-251 cells (PFA-fixed/Triton X-100 permeabilized) labeling MEKK3 with ab219994 at 4 µg/mL (green).

References

ab219994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up