Overview

  • Product name

  • Description

    Rabbit polyclonal to MelanA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human MelanA aa 50-100 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPN A


    Database link: Q16655

  • Positive control

    • Mouse melanoma tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab216420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.

Target

  • Function

    Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.
  • Tissue specificity

    Expression is restricted to melanoma and melanocyte cell lines and retina.
  • Post-translational
    modifications

    Acylated.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus. Golgi apparatus > trans-Golgi network membrane. Melanosome. Also found in small vesicles and tubules dispersed over the entire cytoplasm. A small fraction of the protein is inserted into the membrane in an inverted orientation. Inversion of membrane topology results in the relocalization of the protein from a predominant Golgi/post-Golgi area to the endoplasmic reticulum. Melanoma cells expressing the protein with an inverted membrane topology are more effectively recognized by specific cytolytic T-lymphocytes than those expressing the protein in its native membrane orientation.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen LB39 AA antibody
    • Antigen LB39-AA antibody
    • Antigen SK29 AA antibody
    • Antigen SK29-AA antibody
    • MAR1_HUMAN antibody
    • MART 1 antibody
    • MART-1 antibody
    • MART1 antibody
    • Melan A antibody
    • Melan A protein antibody
    • Melanoma antigen recognized by T cells 1 antibody
    • Melanoma antigen recognized by T-cells 1 antibody
    • MLAN A antibody
    • MLANA antibody
    • OTTHUMP00000021036 antibody
    • OTTHUMP00000021037 antibody
    • OTTHUMP00000021038 antibody
    • Protein Melan-A antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse melanoma labeling MelanA with ab216420 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab216420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up