Overview

  • Product name

    Anti-MelanA antibody [MLANA/788]
    See all MelanA primary antibodies
  • Description

    Mouse monoclonal [MLANA/788] to MelanA
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog
  • Immunogen

    Recombinant full length protein corresponding to Human MelanA aa 1-118.
    Sequence:

    MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRR RNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNA PPAYEKLSAEQSPPPYSP


    Database link: Q16655

  • Positive control

    • Human testis and melanoma tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 99% PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    ab215756 was purified from Bioreactor Concentrate by Protein A/G.
  • Clonality

    Monoclonal
  • Clone number

    MLANA/788
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab215756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.
  • Tissue specificity

    Expression is restricted to melanoma and melanocyte cell lines and retina.
  • Post-translational
    modifications

    Acylated.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus. Golgi apparatus > trans-Golgi network membrane. Melanosome. Also found in small vesicles and tubules dispersed over the entire cytoplasm. A small fraction of the protein is inserted into the membrane in an inverted orientation. Inversion of membrane topology results in the relocalization of the protein from a predominant Golgi/post-Golgi area to the endoplasmic reticulum. Melanoma cells expressing the protein with an inverted membrane topology are more effectively recognized by specific cytolytic T-lymphocytes than those expressing the protein in its native membrane orientation.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen LB39 AA antibody
    • Antigen LB39-AA antibody
    • Antigen SK29 AA antibody
    • Antigen SK29-AA antibody
    • MAR1_HUMAN antibody
    • MART 1 antibody
    • MART-1 antibody
    • MART1 antibody
    • Melan A antibody
    • Melan A protein antibody
    • Melanoma antigen recognized by T cells 1 antibody
    • Melanoma antigen recognized by T-cells 1 antibody
    • MLAN A antibody
    • MLANA antibody
    • OTTHUMP00000021036 antibody
    • OTTHUMP00000021037 antibody
    • OTTHUMP00000021038 antibody
    • Protein Melan-A antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testis tissue labeling MelanA with ab215756 at 1.0 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human melanoma tissue labeling MelanA with ab215756 at 1.0 µg/ml.

References

ab215756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up