Overview

  • Product name

    Anti-MelanA antibody [OTI3E2]
    See all MelanA primary antibodies
  • Description

    Mouse monoclonal [OTI3E2] to MelanA
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MelanA aa 1-118.
    Sequence:

    MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRR RNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNA PPAYEKLSAEQSPPPYSP

  • Positive control

    • WB: MDCK and HEK293T transfected with pCMV6-ENTRY MelanA cDNA cell lysate IHC-P: Human kidney and pancreas tissues ICC/IF: COS7 cells transiently transfected with pCMV6-ENTRY MelanA
  • General notes

    The clone number has been updated from 3E2 to OTI3E2, both clone numbers name the same clone.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 1% BSA, PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography
  • Clonality

    Monoclonal
  • Clone number

    OTI3E2
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab140503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/4000. Predicted molecular weight: 13 kDa.
IHC-P 1/150.
ICC/IF 1/100.

Target

  • Function

    Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.
  • Tissue specificity

    Expression is restricted to melanoma and melanocyte cell lines and retina.
  • Post-translational
    modifications

    Acylated.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus. Golgi apparatus > trans-Golgi network membrane. Melanosome. Also found in small vesicles and tubules dispersed over the entire cytoplasm. A small fraction of the protein is inserted into the membrane in an inverted orientation. Inversion of membrane topology results in the relocalization of the protein from a predominant Golgi/post-Golgi area to the endoplasmic reticulum. Melanoma cells expressing the protein with an inverted membrane topology are more effectively recognized by specific cytolytic T-lymphocytes than those expressing the protein in its native membrane orientation.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen LB39 AA antibody
    • Antigen LB39-AA antibody
    • Antigen SK29 AA antibody
    • Antigen SK29-AA antibody
    • MAR1_HUMAN antibody
    • MART 1 antibody
    • MART-1 antibody
    • MART1 antibody
    • Melan A antibody
    • Melan A protein antibody
    • Melanoma antigen recognized by T cells 1 antibody
    • Melanoma antigen recognized by T-cells 1 antibody
    • MLAN A antibody
    • MLANA antibody
    • OTTHUMP00000021036 antibody
    • OTTHUMP00000021037 antibody
    • OTTHUMP00000021038 antibody
    • Protein Melan-A antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labelling MelanA with ab140503 at 1/150 dilution.
  • Immunofluorescent analysis of COS7 cells transiently transfected with pCMV6-ENTRY MelanA, labelling MelanA with ab140503 at 1/100 dilution.
  • Anti-MelanA antibody [OTI3E2] (ab140503) at 1/200 dilution + MDCK cell lysate at 10 µg

    Predicted band size: 13 kDa

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labelling MelanA with ab140503 at 1/150 dilution.
  • All lanes : Anti-MelanA antibody [OTI3E2] (ab140503) at 1/4000 dilution

    Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY MelanA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 13 kDa

References

ab140503 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140503.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up