Overview

  • Product name

    Anti-Melanoma Inhibitory Activity antibody
    See all Melanoma Inhibitory Activity primary antibodies
  • Description

    Rabbit polyclonal to Melanoma Inhibitory Activity
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Melanoma Inhibitory Activity aa 87-124.
    Sequence:

    SVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTD


    Database link: Q16674

  • Positive control

    • IHC-P: Human prostate and testis tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab238737 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas.
  • Tissue specificity

    All malignant melanoma cell lines tested and infrequently in glioma cell lines.
  • Sequence similarities

    Belongs to the MIA/OTOR family.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    May possess two intramolecular disulfide bonds.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cartilage derived retinoic acid sensitive protein antibody
    • CD RAP antibody
    • CDRAP antibody
    • Melanoma derived growth regulatory protein precursor antibody
    • Melanoma inhibitory activity protein antibody
    • Melanoma-derived growth regulatory protein antibody
    • Mia antibody
    • MIA_HUMAN antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for Melanoma Inhibitory Activity using ab238737 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for Melanoma Inhibitory Activity using ab238737 at 1/100 dilution in immunohistochemical analysis.

References

ab238737 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238737.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up