Overview

  • Product name

    Anti-Melatonin Receptor 1A/MTNR1A antibody
    See all Melatonin Receptor 1A/MTNR1A primary antibodies
  • Description

    Rabbit polyclonal to Melatonin Receptor 1A/MTNR1A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Cow, Human
  • Immunogen

    Synthetic peptide within Human Melatonin Receptor 1A/MTNR1A aa 209-242 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RIWILVLQVRQRVKPDRKPKLKPQDFRNFVTMFV


    Database link: P48039

  • Positive control

    • Rat brain tissue.
  • General notes

     This product was previously labelled as Melatonin Receptor 1A

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/1000.

Target

Images

  • Anti-Melatonin Receptor 1A/MTNR1A antibody (ab203038) at 1/1000 dilution + Cerebrum lysates

    Secondary
    Conjugated secondary antibody at 1/20000 dilution
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Melatonin Receptor 1A/MTNR1A with ab203038 at 1/300 dilution, followed by secondary antibody detection and DAB staining.

References

This product has been referenced in:

  • Chen L  et al. Pinealectomy or light exposure exacerbates biliary damage and liver fibrosis in cholestatic rats through decreased melatonin synthesis. Biochim Biophys Acta Mol Basis Dis 1865:1525-1539 (2019). Read more (PubMed: 30890428) »
  • Huang CC  et al. Melatonin attenuates TNF-a and IL-1ß expression in synovial fibroblasts and diminishes cartilage degradation: Implications for the treatment of rheumatoid arthritis. J Pineal Res 66:e12560 (2019). Read more (PubMed: 30648758) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up