Overview

  • Product name

    Anti-Melatonin Receptor 1B/MTNR1B antibody
    See all Melatonin Receptor 1B/MTNR1B primary antibodies
  • Description

    Rabbit polyclonal to Melatonin Receptor 1B/MTNR1B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Cow, Human
  • Immunogen

    Synthetic peptide within Human Melatonin Receptor 1B/MTNR1B aa 222-253 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RIWVLVLQARRKAKPESRLCLKPSDLRSFLTM


    Database link: P49286

  • Positive control

    • Rat brain and retina tissues.
  • General notes

     This product was previously labelled as Melatonin Receptor 1B

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 40 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe please use a dilution of 1/50 - 1/200.

ICC/IF 1/50 - 1/200.

Target

  • Function

    High affinity receptor for melatonin. Likely to mediates the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity.
  • Tissue specificity

    Expressed in retina and less in brain and hippocampus.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FGQTL2 antibody
    • Mel 1b antibody
    • Mel 1b melatonin receptor antibody
    • Mel 1B R antibody
    • MEL-1B-R antibody
    • Mel1b antibody
    • Mel1b melatonin receptor antibody
    • Mel1b receptor antibody
    • Mel1BR antibody
    • melatonin receptor 1B antibody
    • Melatonin receptor MEL 1B antibody
    • Melatonin receptor MEL1B antibody
    • Melatonin receptor type 1B antibody
    • MT 2 antibody
    • MT 2 melatonin receptor antibody
    • MT2 antibody
    • MT2 melatonin receptor antibody
    • Mtnr 1b antibody
    • Mtnr1b antibody
    • MTR1B_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain sections labeling Melatonin Receptor 1B/MTNR1B with ab203346 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat retina sections labeling Melatonin Receptor 1B/MTNR1B with ab203346 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Xiao L  et al. Profile of melatonin and its receptors and synthesizing enzymes in cumulus-oocyte complexes of the developing sheep antral follicle-a potential estradiol-mediated mechanism. Reprod Biol Endocrinol 17:1 (2019). Read more (PubMed: 30606208) »
  • Chen L  et al. Pinealectomy or light exposure exacerbates biliary damage and liver fibrosis in cholestatic rats through decreased melatonin synthesis. Biochim Biophys Acta Mol Basis Dis 1865:1525-1539 (2019). Read more (PubMed: 30890428) »
See all 7 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up