Overview

  • Product name

    Anti-Meprin alpha antibody
    See all Meprin alpha primary antibodies
  • Description

    Rabbit polyclonal to Meprin alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Meprin alpha aa 213-506. (Expressed in E.coli).
    Sequence:

    HYQPFSFNKNASVPTITAKIPEFNSIIGQRLDFSAIDLERLNRMYNCTTT HTLLDHCTFEKANICGMIQGTRDDTDWAHQDSAQAGEVDHTLLGQCTGAG YFMQFSTSSGSAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLVVWV RRDDSTGNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDP QNSTGGIYLDDITLTETPCPTGVWTVRNFSQVLENTSKGDKLQSPRFYNS EGYGFGVTLYPNSRESSGYLRLAFHVCSGENDAILEWPVENRQV


    Database link: Q16819

  • Positive control

    • IHC-P: Human kidney tissue. WB: Rat and mouse kidney lysates; Recombinant human Meprin alpha protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232892 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 84 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Sequence similarities

    Belongs to the peptidase M12A family.
    Contains 1 EGF-like domain.
    Contains 1 MAM domain.
    Contains 1 MATH domain.
  • Post-translational
    modifications

    N-glycosylated; contains GlcNAc, galactose, mannose and a small amount of fucose.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Endopeptidase 2 antibody
    • Endopeptidase-2 antibody
    • Mep1a antibody
    • MEP1A_HUMAN antibody
    • Meprin A alpha (PABA peptide hydrolase) antibody
    • Meprin A alpha subunit precursor antibody
    • Meprin A subunit alpha antibody
    • N benzoyl L tyrosyl P amino benzoic acid hydrolase alpha subunit antibody
    • N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit alpha antibody
    • PABA peptide hydrolase antibody
    • PPH alpha antibody
    • PPHA antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for Meprin alpha using ab232892 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Meprin alpha antibody (ab232892) at 2 µg/ml + Recombinant human Meprin alpha protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 84 kDa

  • All lanes : Anti-Meprin alpha antibody (ab232892) at 2 µg/ml

    Lane 1 : Rat kidney lysate
    Lane 2 : Mouse kidney lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 84 kDa

References

ab232892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up