Anti-MESH1 antibody (ab243724)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MESH1 antibody
See all MESH1 primary antibodies -
Description
Rabbit polyclonal to MESH1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MESH1 aa 96-175.
Sequence:PKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEGWSEHRVQE YFEWAAQVVKGLQGTNRQLEEALKHLFKQR
Database link: Q8N4P3 -
Positive control
- IHC-P: Human stomach tissue. WB: RT4 cell lysate. ICC/IF: U-251 MG cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab243724 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. PFA/Triton X-100 fixed/permeabilized |
|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | Use a concentration of 0.4 µg/ml. |
Target
-
Function
ppGpp hydrolyzing enzyme involved in starvation response. -
Sequence similarities
Belongs to the MESH1 family.
Contains 1 HD domain. - Information by UniProt
-
Database links
- Entrez Gene: 374659 Human
- SwissProt: Q8N4P3 Human
- Unigene: 349979 Human
-
Alternative names
- (ppGpp)ase antibody
- 5''-bis(diphosphate) 3''-pyrophosphohydrolase MESH1 antibody
- Guanosine-3'' antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MESH1 antibody (ab243724)Formalin-fixed, paraffin-embedded human stomach tissue stained for MESH1 using ab243724 at 1/50 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-MESH1 antibody (ab243724)Paraformaldehyde-fixed, Triton X-100 permeablized U-251 MG (human brain glioma cell line) cells stained for MESH1 (Green) using ab243724 at 4 µg/mL in ICC/IF analysis.
-
Western blot - Anti-MESH1 antibody (ab243724)Anti-MESH1 antibody (ab243724) at 0.4 µg/ml + RT4 (Human urinary bladder cancer cell line) whole cell lysate
Datasheets and documents
References
ab243724 has not yet been referenced specifically in any publications.
