Anti-MESH1 antibody (ab243724)
Key features and details
- Rabbit polyclonal to MESH1
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MESH1 antibody
See all MESH1 primary antibodies -
Description
Rabbit polyclonal to MESH1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MESH1 aa 96-175.
Sequence:PKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEGWSEHRVQE YFEWAAQVVKGLQGTNRQLEEALKHLFKQR
Database link: Q8N4P3 -
Positive control
- IHC-P: Human fallopian tube, pancreas, and kidney tissues; WB: RT4 cell lysate; ICC/IF: U-251 MG cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab243724 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. |
Target
-
Function
ppGpp hydrolyzing enzyme involved in starvation response. -
Sequence similarities
Belongs to the MESH1 family.
Contains 1 HD domain. - Information by UniProt
-
Database links
- Entrez Gene: 374659 Human
- SwissProt: Q8N4P3 Human
- Unigene: 349979 Human
-
Alternative names
- (ppGpp)ase antibody
- 5''-bis(diphosphate) 3''-pyrophosphohydrolase MESH1 antibody
- Guanosine-3'' antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MESH1 antibody (ab243724)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human fallopian tube tissue labelling MESH1 with ab243724 at 1/50 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Paraformaldehyde-fixed, Triton X-100 permeablized U-251 MG (human brain glioma cell line) cells stained for MESH1 (Green) using ab243724 at 4 µg/mL in ICC/IF analysis.
-
Anti-MESH1 antibody (ab243724) at 0.4 µg/ml + RT4 (Human urinary bladder cancer cell line) whole cell lysate
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MESH1 antibody (ab243724)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pancreas tissue labelling MESH1 with ab243724 at 1/50 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MESH1 antibody (ab243724)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling MESH1 with ab243724 at 1/50 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MESH1 antibody (ab243724)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human skeletal muscle tissue labelling MESH1 with ab243724 at 1/50 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243724 has not yet been referenced specifically in any publications.