Overview

  • Product name

  • Description

    Rabbit polyclonal to Mesp1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Mesp1 aa 149-268.
    Sequence:

    RRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQAEGQGQGRGLGLVSAVRAG ASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAMEPSPPSPLLPGDVL ALLETWMPLSPLEWLPEEPK


    Database link: Q9BRJ9

  • Positive control

    • IHC-P: Human pancreatic tissue and pancreatic cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Transcription factor. Plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. Defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bHLHc5 antibody
    • Class C basic helix-loop-helix protein 5 antibody
    • Mesoderm posterior 1 antibody
    • Mesoderm posterior 1 homolog (mouse) antibody
    • Mesoderm posterior 1 homolog antibody
    • Mesoderm posterior protein 1 antibody
    • MESP 1 antibody
    • Mesp1 antibody
    • MESP1_HUMAN antibody
    • MGC10676 antibody
    • MGC159208 antibody
    • MGC159210 antibody
    • OTTMUSP00000030151 antibody
    see all

Images

  • Paraffin-embedded human pancreatic tissue stained for Mesp1 using ab230308 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for Mesp1 using ab230308 at 1/100 dilution in immunohistochemical analysis.

References

ab230308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up