Overview

  • Product name

  • Description

    Rabbit polyclonal to Mesp2
  • Host species

    Rabbit
  • Specificity

    ab200690 detects endogenous levels of MESP2 protein.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human Mesp2 aa 276-321 (C terminal).
    Sequence:

    QGCPWTQSSPEPRNPPVPWTAAPATLELAAVYQGLSVSPEPCLSLG


    Database link: Q0VG99

  • Positive control

    • A549, sp2/0 and H9C2 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab200690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration.

Target

  • Function

    Transcription factor with important role in somitogenesis. Defines the rostrocaudal patterning of the somite by participating in distinct Notch pathways. Regulates also the FGF signaling pathway. Specifies the rostral half of the somites. Generates rostro-caudal polarity of somites by down-regulating in the presumptive rostral domain DLL1, a Notch ligand. Participates in the segment border formation by activating in the anterior presomitic mesoderm LFNG, a negative regulator of DLL1-Notch signaling. Acts as a strong suppressor of Notch activity. Together with MESP1 is involved in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm.
  • Involvement in disease

    Defects in MESP2 are the cause of spondylocostal dysostosis type 2 (SCDO2) [MIM:608681]. An autosomal recessive condition of variable severity associated with vertebral and rib segmentation defects. The main skeletal malformations include fusion of vertebrae, hemivertebrae, fusion of certain ribs, and other rib malformations. Deformity of the chest and spine (severe scoliosis, kyphoscoliosis and lordosis) is a natural consequence of the malformation and leads to a dwarf-like appearance. As the thorax is small, infants frequently have respiratory insufficiency and repeated respiratory infections resulting in life-threatening complications in the first year of life.
  • Sequence similarities

    Contains 1 bHLH (basic helix-loop-helix) domain.
  • Post-translational
    modifications

    Degraded by the proteasome.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Basic helix loop helix protein MESP 2 antibody
    • Basic helix loop helix protein MESP2 antibody
    • BHLH protein MesP2 antibody
    • bHLHc6 antibody
    • Class C basic helix-loop-helix protein 6 antibody
    • Hypothetical class II basic helix loop helix protein MESP 2 antibody
    • Hypothetical class II basic helix loop helix protein MESP2 antibody
    • Mesoderm posterior 2 antibody
    • mesoderm posterior 2 homolog (mouse) antibody
    • Mesoderm posterior 2 homolog antibody
    • Mesoderm posterior protein 2 antibody
    • Mesp 2 antibody
    • MESP2 antibody
    • MESP2_HUMAN antibody
    • SCDO 2 antibody
    • SCDO2 antibody
    see all

Images

  • All lanes : Anti-Mesp2 antibody (ab200690)

    Lane 1 : A549 whole cell lysate
    Lane 2 : sp2/0 whole cell lysate
    Lane 3 : H9C2 whole cell lysate

References

ab200690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up