Overview

  • Product name

  • Description

    Rabbit polyclonal to MEST
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human MEST aa 146-335.
    Sequence:

    HDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLK DGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIRNNDGN LVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLEL YRKTLPRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF


    Database link: Q5EB52

  • Positive control

    • IHC-P: Human breast cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Highly expressed in hydatidiform moles, but barely expressed in dermoid cysts. Biallelic expression is detected in blood lymphocytes. Seems to imprinted in an isoform-specific manner rather than in a tissue-specific manner in lymphocytes. Isoform 1 is expressed only from the paternal allele. Isoform 2 is expressed from both the paternal allele and the maternal allele.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily.
  • Developmental stage

    Monoallelic expression of paternally derived allele was observed in all fetal tissues examined, including brain, skeletal muscle, kidney, adrenal, tongue, heart, skin and placenta. In 75-day fetus, expressed in the amnion, brain, heart, lung, stomach, gut, adrenal, kidney, muscle and liver.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686L18234 antibody
    • EC 3.-.-.- antibody
    • Mesoderm specific transcript (mouse) homolog antibody
    • Mesoderm specific transcript homolog (mouse) antibody
    • Mesoderm-specific transcript homolog protein antibody
    • MEST antibody
    • MEST_HUMAN antibody
    • MGC111102 antibody
    • MGC8703 antibody
    • OTTHUMP00000210362 antibody
    • OTTHUMP00000210364 antibody
    • OTTHUMP00000210367 antibody
    • Paternally expressed gene 1 antibody
    • Paternally-expressed gene 1 protein antibody
    • PEG1 antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for MEST using ab229955 at 1/100 dilution in immunohistochemical analysis.

References

ab229955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up