Overview

  • Product name

    Anti-Metabotropic Glutamate Receptor 3/MGLUR3 antibody
    See all Metabotropic Glutamate Receptor 3/MGLUR3 primary antibodies
  • Description

    Rabbit polyclonal to Metabotropic Glutamate Receptor 3/MGLUR3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Pig
    Predicted to work with: Mouse, Human, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Metabotropic Glutamate Receptor 3/MGLUR3 aa 568-819. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    DYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIKHNNTPLVKASGRELCYI LLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALLTKTNCIA RIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRY TLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNE AKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGC LF


    Database link: Q14832

  • Positive control

    • WB: Recombinant human Metabotropic Glutamate Receptor 3/MGLUR3 protein; Pig brain and rat brain lysates.
  • General notes

     This product was previously labelled as Metabotropic Glutamate Receptor 3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 99 kDa.

Target

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) staining Metabotropic Glutamate Receptor 3/MGLUR3 in Human Cerebellum Tissue useing ab232962 20μg/ml. 

  • All lanes : Anti-Metabotropic Glutamate Receptor 3/MGLUR3 antibody (ab232962) at 1 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : Rat brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 99 kDa

  • Anti-Metabotropic Glutamate Receptor 3/MGLUR3 antibody (ab232962) at 2 µg/ml + Recombinant human Metabotropic Glutamate Receptor 3/MGLUR3

    Predicted band size: 99 kDa

References

ab232962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up