Overview

  • Product name

    Anti-Metabotropic Glutamate Receptor 7/MGLUR7 antibody [7G8D3]
    See all Metabotropic Glutamate Receptor 7/MGLUR7 primary antibodies
  • Description

    Mouse monoclonal [7G8D3] to Metabotropic Glutamate Receptor 7/MGLUR7
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Metabotropic Glutamate Receptor 7/MGLUR7 aa 454-590. (Expressed in E.coli).
    Sequence:

    NVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQ LNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQY QFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPW


    Database link: Q14831

  • Positive control

    • WB: Recombinant human Metabotropic Glutamate Receptor 7/MGLUR7 (aa 454-590) protein; Metabotropic Glutamate Receptor 7/MGLUR7 (aa 454-590)-hIgGFc transfected HEK-293 cell lysate. ICC/IF: HeLa and SMMC-7721 cells. Flow Cyt: SH-SY5Y cells.
  • General notes

     This product was previously labelled as Metabotropic Glutamate Receptor 7

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    7G8D3
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 102 kDa.
Flow Cyt 1/200 - 1/400.
ICC/IF 1/200 - 1/1000.

Target

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Metabotropic Glutamate Receptor 7/MGLUR7 (green) using ab233722 at 1/200 dilution in ICC/IF.

    Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

  • Anti-Metabotropic Glutamate Receptor 7/MGLUR7 antibody [7G8D3] (ab233722) at 1/500 dilution + Recombinant human Metabotropic Glutamate Receptor 7/MGLUR7 (aa 454-590) protein

    Predicted band size: 102 kDa



    Expected MW is 41.7 kDa.

  • All lanes : Anti-Metabotropic Glutamate Receptor 7/MGLUR7 antibody [7G8D3] (ab233722) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Metabotropic Glutamate Receptor 7/MGLUR7 (aa 454-590)-hIgGFc transfected HEK-293 cell lysate

    Predicted band size: 102 kDa

  • SMMC-7721 (human hepatocarcinoma cell line) cells stained for Metabotropic Glutamate Receptor 7/MGLUR7 (green) using ab233722 at 1/200 dilution in ICC/IF.

    Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

  • Flow cytometric analysis of SH-SY5Y (human neuroblastoma cell line from bone marrow) cell line labeling Metabotropic Glutamate Receptor 7/MGLUR7 with ab233722 at 1/200 dilution (green) compared with a negative control (red).

References

ab233722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up