Overview

  • Product name
  • Description
    Mouse polyclonal to MetRS/MARS
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human MetRS/MARS aa 1-900.
    Sequence:

    MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPEDCVVPFLTRPKVPV LQLDSGNYLFSTSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAAL YYLVVQGKKGEDVLGSVRRALTHIDHSLSRQNCPFLAGETESLADIVLWG ALYPLLQDPAYLPEELSALHSWFQTLSTQEPCQRAAETVLKQQGVLALRP YLQKQPQPSPAEGRAVTNEPEEEELATLSEEEIAMAVTAWEKGLESLPPL RPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL RQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNIS FDIFGRTTTPQQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRF VEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHL FLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLK WGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWWKNPEQVDLYQ FMAKDNVPFHSLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGV GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNL GNFINRAGMFVSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVR IRDALRSILTISRHGNQYIQVNEPWKRIKGSEADRQRAGTVTGLAVNIAA LLSVMLQPYMPTVSATIQAQLQLPPPACSILLTNFLCTLPAGHQIGTVSP LFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVT KQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK


    Database link: NP_004981.2

  • Positive control
    • Human pancreas tissue lysate, MARS transfected 293T cell line lysate, HeLa cells

Properties

Applications

Our Abpromise guarantee covers the use of ab167360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 101 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Sequence similarities
    Belongs to the class-I aminoacyl-tRNA synthetase family.
    Contains 1 GST C-terminal domain.
    Contains 1 WHEP-TRS domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • cytoplasmic antibody
    • FLJ35667 antibody
    • Mars antibody
    • Methionine tRNA ligase 1 antibody
    • Methionine tRNA ligase 1 cytoplasmic antibody
    • Methionine tRNA ligase antibody
    • Methionine tRNA synthetase antibody
    • Methionine--tRNA ligase antibody
    • Methionyl tRNA synthetase cytoplasmic antibody
    • Methionyl-tRNA synthetase antibody
    • MetRS antibody
    • MRS antibody
    • MTRNS antibody
    • SYMC_HUMAN antibody
    see all

Images

  • Anti-MetRS/MARS antibody (ab167360) at 1 µg/ml + Human pancreas tissue lysate at 50 µg

    Secondary
    Goat anti-Mouse IgG HRP at 1/2500 dilution

    Predicted band size: 101 kDa

  • All lanes : Anti-MetRS/MARS antibody (ab167360) at 1 µg/ml

    Lane 1 : MARS transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat anti-Mouse IgG HRP at 1/2500 dilution

    Predicted band size: 101 kDa

  • Immunofluorescence analysis of HeLa cells labeling MARS using ab167360 at 10 µg/ml.

References

ab167360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up