Overview

  • Product name

    Anti-METTL12 antibody
  • Description

    Rabbit polyclonal to METTL12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human METTL12 aa 91-162.
    Sequence:

    TGLYTKSPHPVDVLGVDFSPVAVAHMNSLLEGGPGQTPLCPGHPASSLHF MHADAQNLGAVASSGSFQLLLD


    Database link: A8MUP2

  • Positive control

    • IHC-P: Human testis tissue. WB: METTL12 over-expression HEK-293T lysate (Co-expressed with a C-terminal myc-DDK tag).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab243520 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 26 kDa.

Target

Images

  • Paraffin-embedded human testis tissue stained for METTL12 using ab243520 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-METTL12 antibody (ab243520) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : METTL12 over-expression HEK-293T lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)

    Predicted band size: 26 kDa

References

ab243520 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243520.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up