Overview

  • Product name

  • Description

    Rabbit polyclonal to METTL14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human METTL14 aa 24-206.
    Sequence:

    GAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETD EDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHF VDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQAD IEAFDIRELTPKFDVILLEPPLEEYYRETGITA


    Database link: Q9HCE5

  • Positive control

    • WB: SH-SY5Y whole cell lysate. IHC-P: Human gastric cancer and testis tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 53 kDa (predicted molecular weight: 52 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    N6-methyltransferase that methylates adenosine residues of some mRNAs and acts as a regulator of the circadian clock and differentiation of embryonic stem cells. N6-methyladenosine (m6A), which takes place at the 5'-[AG]GAC-3' consensus sites of some mRNAs, plays a role in the efficiency of mRNA splicing, processing and mRNA stability (PubMed:24316715, PubMed:24407421, PubMed:25719671). M6A regulates the length of the circadian clock: acts as a early pace-setter in the circadian loop. M6A also acts as a regulator of mRNA stability: in embryonic stem cells (ESCs), m6A methylation of mRNAs encoding key naive pluripotency-promoting transcripts results in transcript destabilization.
  • Sequence similarities

    Belongs to the MT-A70-like family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1627 antibody
    • MET14_HUMAN antibody
    • Methyltransferase like 14 antibody
    • Methyltransferase-like protein 14 antibody
    • METTL14 antibody
    • N6-adenosine-methyltransferase subunit METTL14 antibody
    • OTTHUMP00000219837 antibody
    see all

Images

  • Anti-METTL14 antibody (ab223090) at 1/1000 dilution + SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 52 kDa
    Observed band size: 53 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human gastric cancer tissue stained for METTL14 using ab223090 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for METTL14 using ab223090 at 1/100 dilution in immunohistochemical analysis.

References

ab223090 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223090.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up