Overview

  • Product name

    Anti-METTL14 antibody [CL4252]
    See all METTL14 primary antibodies
  • Description

    Mouse monoclonal [CL4252] to METTL14
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Cow, Orangutan
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human METTL14 aa 1-91.
    Sequence:

    RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAE TRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE


    Database link: Q9HCE5

  • Positive control

    • Human testis, Human endometrium, Human prostate, Human cervix, Human cerebral cortex and Human duodenum tissues; A431 cell line lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL4252
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 52 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    N6-methyltransferase that methylates adenosine residues of some mRNAs and acts as a regulator of the circadian clock and differentiation of embryonic stem cells. N6-methyladenosine (m6A), which takes place at the 5'-[AG]GAC-3' consensus sites of some mRNAs, plays a role in the efficiency of mRNA splicing, processing and mRNA stability (PubMed:24316715, PubMed:24407421, PubMed:25719671). M6A regulates the length of the circadian clock: acts as a early pace-setter in the circadian loop. M6A also acts as a regulator of mRNA stability: in embryonic stem cells (ESCs), m6A methylation of mRNAs encoding key naive pluripotency-promoting transcripts results in transcript destabilization.
  • Sequence similarities

    Belongs to the MT-A70-like family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1627 antibody
    • MET14_HUMAN antibody
    • Methyltransferase like 14 antibody
    • Methyltransferase-like protein 14 antibody
    • METTL14 antibody
    • N6-adenosine-methyltransferase subunit METTL14 antibody
    • OTTHUMP00000219837 antibody
    see all

Images

  • Anti-METTL14 antibody [CL4252] (ab220030) at 1/500 dilution + A431 cell line lysate

    Predicted band size: 52 kDa

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human duodenum tissue labeling METTL14 with ab220030 at 1/1000 dilution, showing strong nuclear positivity in glandular cells and in the connective tissue.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human cerebral cortex tissue labeling METTL14 with ab220030 at 1/1000 dilution, showing moderate nuclear positivity in neurons.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human cervix tissue labeling METTL14 with ab220030 at 1/1000 dilution, showing strong nuclear positivity in squamous ephitelium and connective tissue cells.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human prostate tissue labeling METTL14 with ab220030 at 1/1000 dilution, showing strong nuclear positivity in glandular cells and in smooth muscle.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human endometrium tissue labeling METTL14 with ab220030 at 1/1000 dilution, showing strong nuclear immunoreactivity in glandular cells and in stroma.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human testis tissue labeling METTL14 with ab220030 at 1/1000 dilution, showing strong nuclear positivity in cells in seminiferous tubes.

References

ab220030 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (islet)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10mM sodium citrate, PH6
Permeabilization
No
Specification
islet
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 18°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Oct 03 2019

Application
Western blot
Sample
Pig Cell lysate - whole cell (Swine Testicle cells (ST))
Gel Running Conditions
Reduced Denaturing (10% polyacrylamide gel)
Loading amount
20 µg
Specification
Swine Testicle cells (ST)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted May 11 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up