Overview

  • Product name

    Anti-METTL14 antibody [CL4254]
    See all METTL14 primary antibodies
  • Description

    Mouse monoclonal [CL4254] to METTL14
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Cow, Orangutan
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human METTL14 aa 1-91.
    Sequence:

    RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAE TRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE


    Database link: Q9HCE5

  • Positive control

    • Human endometrium, Human testis, Human fallopian tubes, Human prostate and Human duodenum tissues; A431 cell line lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL4254
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 52 kDa.

Target

  • Function

    N6-methyltransferase that methylates adenosine residues of some mRNAs and acts as a regulator of the circadian clock and differentiation of embryonic stem cells. N6-methyladenosine (m6A), which takes place at the 5'-[AG]GAC-3' consensus sites of some mRNAs, plays a role in the efficiency of mRNA splicing, processing and mRNA stability (PubMed:24316715, PubMed:24407421, PubMed:25719671). M6A regulates the length of the circadian clock: acts as a early pace-setter in the circadian loop. M6A also acts as a regulator of mRNA stability: in embryonic stem cells (ESCs), m6A methylation of mRNAs encoding key naive pluripotency-promoting transcripts results in transcript destabilization.
  • Sequence similarities

    Belongs to the MT-A70-like family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1627 antibody
    • MET14_HUMAN antibody
    • Methyltransferase like 14 antibody
    • Methyltransferase-like protein 14 antibody
    • METTL14 antibody
    • N6-adenosine-methyltransferase subunit METTL14 antibody
    • OTTHUMP00000219837 antibody
    see all

Images

  • Anti-METTL14 antibody [CL4254] (ab220031) at 1/500 dilution + A431 cell line lysate

    Predicted band size: 52 kDa

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human duodenum tissue labeling METTL14 with ab220031 at 1/500 dilution showing nuclear immunoreactivity in glandular cells and in the connective tissue.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human prostate tissue labeling METTL14 with ab220031 at 1/500 dilution showing nuclear immunoreactivity in glandular cells and in smooth muscle cells.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human fallopian tube tissue labeling METTL14 with ab220031 at 1/500 dilution showing nuclear immunoreactivity in glandular cells.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human testis tissue labeling METTL14 with ab220031 at 1/500 dilution showing nuclear immunoreactivity in cells in seminiferous tubules.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human endometrium tissue labeling METTL14 with ab220031 at 1/500 dilution showing nuclear immunoreactivity in glandular cells and in stroma.

References

ab220031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up