Overview

  • Product name

  • Description

    Rabbit polyclonal to METTL16
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cat, Dog, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan
  • Immunogen

    Synthetic peptide within Human METTL16 aa 375-425. The exact sequence is proprietary. NP_076991.3
    Sequence:

    ENSWIHLRRKKRERVRQLREVPRAPEDVIQALEEKKPTPKESGNSQELAR G


    Database link: Q86W50

  • Positive control

    • HeLa, 293T, Jurkat, TCMK-1, NIH3T3 wole cell lysates
  • General notes

     This product was previously labelled as METT10D

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 64 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    Images

    • All lanes : Anti-METTL16 antibody (ab186012) at 0.1 µg/ml

      Lane 1 : HeLa whole cell lysate
      Lane 2 : 293T whole cell lysate
      Lane 3 : Jurkat whole cell lysate
      Lane 4 : TCMK-1 whole cell lysate
      Lane 5 : NIH3T3 whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 64 kDa


      Exposure time: 3 minutes

    References

    This product has been referenced in:

    • Mendel M  et al. Methylation of Structured RNA by the m6A Writer METTL16 Is Essential for Mouse Embryonic Development. Mol Cell 71:986-1000.e11 (2018). Read more (PubMed: 30197299) »
    See 1 Publication for this product

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab186012.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up