Overview

  • Product name

  • Description

    Rabbit polyclonal to METTL16
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human METTL16 aa 41-141.
    Sequence:

    RVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIHWVE DLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFN Y


    Database link: Q86W50

  • Positive control

    • ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as METT10D

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221036 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    METT10D belongs to the methyltransferase superfamily, METT10D/rlmF family. The exact function of METT10D remains unknown. There are two named isoforms.
  • Database links

  • Alternative names

    • 2610100D03Rik antibody
    • 2810013M15Rik antibody
    • A830095F14Rik antibody
    • AI846133 antibody
    • Methyltransferase 10 domain containing antibody
    • Methyltransferase like 16 antibody
    • METT10D antibody
    • MGC3329 antibody
    • OTTMUSP00000006473 antibody
    • Putative methyltransferase METT10D antibody
    • RP23-174M12.2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA fixed, triton X-100 U-251 MG cells labeling METTL16 with ab221036 at 4 µg/mL (green).

References

ab221036 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221036.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up