Overview

  • Product name

  • Description

    Rabbit polyclonal to METTL21A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human METTL21A aa 71-120 (internal sequence).
    Sequence:

    LGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVK


    Database link: NP_660323

  • Positive control

    • Human Fetal Liver lysate
  • General notes

    Previously labelled as FAM119A. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab84523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-METTL21A antibody (ab84523) at 1 µg/ml + Human Fetal Liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1: 50,000

    Predicted band size: 25 kDa
    Observed band size: 25 kDa
    Additional bands at: 44 kDa. We are unsure as to the identity of these extra bands.

References

This product has been referenced in:

  • Sieber J  et al. Lysine trimethylation regulates 78-kDa glucose-regulated protein proteostasis during endoplasmic reticulum stress. J Biol Chem 292:18878-18885 (2017). Read more (PubMed: 28912266) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up