Overview

  • Product name
  • Description
    Rabbit polyclonal to METTL8
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human METTL8 aa 34-212. (BC025250)
    Sequence:

    EASKYWDTFYKIHKNKFFKDRNWLLREFPEILPVDQKPEEKARESSWDHV KTSATNRFSRMHCPTVPDEKNHYEKSSGSSEGQSKTESDFSNLDSEKHKK GPMETGLFPGSNATFRILEVGCGAGNSVFPILNTLENSPESFLYCCDFAS GAVELVKSHSSYRATQCFAFVHDVCDDGL


    Database link: Q9H825-2

  • Positive control
    • HepG2 cell lysate, Human fetal stomach tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000.

Target

  • Relevance
    METTL8 displays signature motifs characteristic of nuclear receptor coregulators and chromatin remodeling enzymes
  • Cellular localization
    Cytoplasmic and Nuclear
  • Database links
  • Alternative names
    • tension induced inhibited protein antibody
    • methyltransferase like 8 antibody
    • methyltransferase like protein 8 antibody
    • TIP antibody

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal stomach tissue labeling METTL8 with ab177201 at 1/100 dilution.

  • Anti-METTL8 antibody (ab177201) at 1/500 dilution + HepG2 cell lysate

References

ab177201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up