Anti-METTL8 antibody (ab177201)
Key features and details
- Rabbit polyclonal to METTL8
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-METTL8 antibody
See all METTL8 primary antibodies -
Description
Rabbit polyclonal to METTL8 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human METTL8 aa 34-212. (BC025250)
Sequence:EASKYWDTFYKIHKNKFFKDRNWLLREFPEILPVDQKPEEKARESSWDHV KTSATNRFSRMHCPTVPDEKNHYEKSSGSSEGQSKTESDFSNLDSEKHKK GPMETGLFPGSNATFRILEVGCGAGNSVFPILNTLENSPESFLYCCDFAS GAVELVKSHSSYRATQCFAFVHDVCDDGL
Database link: Q9H825-2 -
Positive control
- HepG2 whole cell lysate (ab7900), Human fetal stomach tissue
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab177201 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/100 - 1/500. | |
WB | 1/200 - 1/1000. |
Target
-
Relevance
METTL8 displays signature motifs characteristic of nuclear receptor coregulators and chromatin remodeling enzymes -
Cellular localization
Cytoplasmic and Nuclear -
Database links
- Entrez Gene: 79828 Human
- SwissProt: Q9H825 Human
- Unigene: 135146 Human
-
Alternative names
- tension induced inhibited protein antibody
- methyltransferase like 8 antibody
- methyltransferase like protein 8 antibody
- TIP antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-METTL8 antibody (ab177201)
Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal stomach tissue labeling METTL8 with ab177201 at 1/100 dilution.
-
Anti-METTL8 antibody (ab177201) at 1/500 dilution + HepG2 cell lysate
Protocols
References (0)
ab177201 has not yet been referenced specifically in any publications.