Overview

  • Product name
    Anti-MEX3A antibody - N-terminal
    See all MEX3A primary antibodies
  • Description
    Rabbit polyclonal to MEX3A - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human MEX3A aa 172-221 (N terminal). The exact sequence is proprietary.
    Sequence:

    GEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALP


    Database link: A1L020

  • Positive control
    • Human fetal brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab177365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 54 kDa.

Target

  • Relevance
    RNA binding protein, may be involved in post transcriptional regulatory mechanisms.
  • Cellular localization
    Cytoplasmic and Nuclear. Note: Predominantly expressed in the cytoplasm and shuttles between the cytoplasm and the nucleus through the CRM1 export pathway.
  • Database links
  • Alternative names
    • Mex3 homolog A (C. elegans) antibody
    • MEX3A protein antibody
    • Ring finger and KH domain containing 4 antibody
    • Ring finger and KH domain containing protein antibody
    • RKHD4 antibody
    see all

Images

  • Anti-MEX3A antibody - N-terminal (ab177365) at 1 µg/ml + Human fetal brain lysate at 10 µg

    Predicted band size: 54 kDa



    5% milk block used

References

ab177365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up