Anti-MFI2/MTf antibody (ab236732)
Key features and details
- Rabbit polyclonal to MFI2/MTf
- Suitable for: IHC-P, WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MFI2/MTf antibody
See all MFI2/MTf primary antibodies -
Description
Rabbit polyclonal to MFI2/MTf -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MFI2/MTf aa 20-302.
Sequence:GMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAA QEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHV TIDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFG GSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAE GAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWR QCHLARVPAHAVVVRADTDGGLIFRLLNEGQRL
Database link: P08582 -
Positive control
- WB: HEK-293 and HeLa whole cell lysate. IHC-P: Human tonsil tissue. ICC/IF: HepG2 cells.
-
General notes
This product was previously labelled as MFI2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236732 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| WB | 1/500 - 1/5000. Predicted molecular weight: 80 kDa. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
Involved in iron cellular uptake. Seems to be internalized and then recycled back to the cell membrane. Binds a single atom of iron per subunit. Could also bind zinc. -
Tissue specificity
Found predominantly in human melanomas and in certain fetal tissues; also found in liver, epithelium, umbilical chord, placenta and sweat gland ducts. -
Sequence similarities
Belongs to the transferrin family.
Contains 2 transferrin-like domains. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 4241 Human
- Omim: 155750 Human
- SwissProt: P08582 Human
- Unigene: 184727 Human
-
Alternative names
- Antigen p97 antibody
- CD228 antibody
- CD228 antigen antibody
see all
Images
-
Western blot - Anti-MFI2/MTf antibody (ab236732)All lanes : Anti-MFI2/MTf antibody (ab236732) at 1/500 dilution
Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 80 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-MFI2/MTf antibody (ab236732)HepG2 (human liver hepatocellular carcinoma cell line) cells labeling MFI2/MTf (green) using ab236732 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MFI2/MTf antibody (ab236732)Paraffin-embedded human tonsil tissue stained for MFI2/MTf using ab236732 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236732 has not yet been referenced specifically in any publications.
