Anti-MFI2/MTf antibody (ab236732)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MFI2/MTf antibody
See all MFI2/MTf primary antibodies -
Description
Rabbit polyclonal to MFI2/MTf -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MFI2/MTf aa 20-302.
Sequence:GMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAA QEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHV TIDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFG GSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAE GAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWR QCHLARVPAHAVVVRADTDGGLIFRLLNEGQRL
Database link: P08582 -
Positive control
- WB: HEK-293 and HeLa whole cell lysate. IHC-P: Human tonsil tissue. ICC/IF: HepG2 cells.
-
General notes
This product was previously labelled as MFI2
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236732 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| WB | 1/500 - 1/5000. Predicted molecular weight: 80 kDa. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
Involved in iron cellular uptake. Seems to be internalized and then recycled back to the cell membrane. Binds a single atom of iron per subunit. Could also bind zinc. -
Tissue specificity
Found predominantly in human melanomas and in certain fetal tissues; also found in liver, epithelium, umbilical chord, placenta and sweat gland ducts. -
Sequence similarities
Belongs to the transferrin family.
Contains 2 transferrin-like domains. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 4241 Human
- Omim: 155750 Human
- SwissProt: P08582 Human
- Unigene: 184727 Human
-
Alternative names
- Antigen p97 antibody
- CD228 antibody
- CD228 antigen antibody
see all
Images
-
Western blot - Anti-MFI2/MTf antibody (ab236732)All lanes : Anti-MFI2/MTf antibody (ab236732) at 1/500 dilution
Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 80 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-MFI2/MTf antibody (ab236732)HepG2 (human liver hepatocellular carcinoma cell line) cells labeling MFI2/MTf (green) using ab236732 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MFI2/MTf antibody (ab236732)Paraffin-embedded human tonsil tissue stained for MFI2/MTf using ab236732 at 1/100 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab236732 has not yet been referenced specifically in any publications.
