Overview

  • Product name

  • Description

    Rabbit polyclonal to MFI2/MTf
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MFI2/MTf aa 20-302.
    Sequence:

    GMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAA QEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHV TIDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFG GSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAE GAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWR QCHLARVPAHAVVVRADTDGGLIFRLLNEGQRL


    Database link: P08582

  • Positive control

    • WB: HEK-293 and HeLa whole cell lysate. IHC-P: Human tonsil tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as MFI2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 80 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Involved in iron cellular uptake. Seems to be internalized and then recycled back to the cell membrane. Binds a single atom of iron per subunit. Could also bind zinc.
  • Tissue specificity

    Found predominantly in human melanomas and in certain fetal tissues; also found in liver, epithelium, umbilical chord, placenta and sweat gland ducts.
  • Sequence similarities

    Belongs to the transferrin family.
    Contains 2 transferrin-like domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen p97 antibody
    • CD228 antibody
    • CD228 antigen antibody
    • MAP97 antibody
    • Melanoma associated antigen p97 antibody
    • Melanoma-associated antigen p97 antibody
    • Melanotransferrin antibody
    • Mfi2 antibody
    • MTF1 antibody
    • TRFM_HUMAN antibody
    see all

Images

  • All lanes : Anti-MFI2/MTf antibody (ab236732) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 80 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling MFI2/MTf (green) using ab236732 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

  • Paraffin-embedded human tonsil tissue stained for MFI2/MTf using ab236732 at 1/100 dilution in immunohistochemical analysis.

References

ab236732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Bos taurus Cell (epithelial cell line (bovine turbinate))
Permeabilization
Yes - Triton-X
Specification
epithelial cell line (bovine turbinate)
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 27°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Aug 15 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up