Overview

  • Product name

    Anti-MFI2/MTf antibody [MM0810-51Q3]
    See all MFI2/MTf primary antibodies
  • Description

    Mouse monoclonal [MM0810-51Q3] to MFI2/MTf
  • Host species

    Mouse
  • Tested applications

    Suitable for: ELISA, Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rabbit
  • Immunogen

    Recombinant full length protein corresponding to Human MFI2/MTf aa 20-710.
    Sequence:

    GMEVRWCATSDPEQHKCGNMSEAFREAGIQPSLLCVRGTSADHCVQLIAA QEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHV TIDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFG GSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAE GAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWR QCHLARVPAHAVVVRADTDGGLIFRLLNEGQRLFSHEGSSFQMFSSEAYG QKDLLFKDSTSELVPIATQTYEAWLGHEYLHAMKGLLCDPNRLPPYLRWC VLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVT LSGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDE LRGKRSCHAGFGSPAGWDVPVGALIQRGFIRPKDCDVLTAVSEFFNASCV PVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENAGD VAFVRHTTVFDNTNGHNSEPWAAELRSEDYELLCPNGARAEVSQFAACNL AQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQ DLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQCS


    Database link: P08582

  • General notes

     This product was previously labelled as MFI2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab201922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
Flow Cyt Use at an assay dependent concentration.
WB 1/1000 - 1/2000. Predicted molecular weight: 80 kDa.

Target

  • Function

    Involved in iron cellular uptake. Seems to be internalized and then recycled back to the cell membrane. Binds a single atom of iron per subunit. Could also bind zinc.
  • Tissue specificity

    Found predominantly in human melanomas and in certain fetal tissues; also found in liver, epithelium, umbilical chord, placenta and sweat gland ducts.
  • Sequence similarities

    Belongs to the transferrin family.
    Contains 2 transferrin-like domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen p97 antibody
    • CD228 antibody
    • CD228 antigen antibody
    • MAP97 antibody
    • Melanoma associated antigen p97 antibody
    • Melanoma-associated antigen p97 antibody
    • Melanotransferrin antibody
    • Mfi2 antibody
    • MTF1 antibody
    • TRFM_HUMAN antibody
    see all

Images

References

ab201922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up