Anti-MFSD2A/NLS1 antibody (ab177881)
Key features and details
- Rabbit polyclonal to MFSD2A/NLS1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MFSD2A/NLS1 antibody
See all MFSD2A/NLS1 primary antibodies -
Description
Rabbit polyclonal to MFSD2A/NLS1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Zebrafish -
Immunogen
Synthetic peptide within Human MFSD2A/NLS1 aa 183-232. The exact sequence is proprietary.
Sequence:MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS
Database link: Q8NA29 -
Positive control
- WB: Human thyroid tumor and lung tissue lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.09% Sodium azide
Constituents: 2% Sucrose, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab177881 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 60, 50 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 60, 50 kDa. |
Target
-
Function
Play a role in thermogenesis via beta-adrenergic signaling pathway. -
Sequence similarities
Belongs to the major facilitator superfamily. -
Cellular localization
Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 512633 Cow
- Entrez Gene: 84879 Human
- Entrez Gene: 76574 Mouse
- Entrez Gene: 298504 Rat
- Omim: 614397 Human
- SwissProt: Q8NA29 Human
- SwissProt: Q9DA75 Mouse
- Unigene: 655177 Human
see all -
Alternative names
- 1700018O18Rik antibody
- FLJ14490 antibody
- FLJ35904 antibody
see all
Images
-
Anti-MFSD2A/NLS1 antibody (ab177881) at 1 µg/ml + Human thyroid tumour lysate at 10 µg
Predicted band size: 60, 50 kDaWestern blot analysis of human thyroid tumor lysate labeling MFSD2A/NLS1 with ab177881.
-
All lanes : Anti-MFSD2A/NLS1 antibody (ab177881) at 1 µg/ml
Lane 1 : Human lung lysate
Lane 2 : HepG2 cell lysate
Lysates/proteins at 25 µg per lane.
Predicted band size: 60, 50 kDaWestern blot analysis labeling MFSD2A/NLS1 with ab177881.
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab177881 has been referenced in 3 publications.
- Sánchez-Campillo M et al. Child Head Circumference and Placental MFSD2a Expression Are Associated to the Level of MFSD2a in Maternal Blood During Pregnancy. Front Endocrinol (Lausanne) 11:38 (2020). PubMed: 32117064
- James-Allan LB et al. Changes in Placental Nutrient Transporter Protein Expression and Activity Across Gestation in Normal and Obese Women. Reprod Sci 27:1758-1769 (2020). PubMed: 32072607
- Yang J et al. Burns Impair Blood-Brain Barrier and Mesenchymal Stem Cells Can Reverse the Process in Mice. Front Immunol 11:578879 (2020). PubMed: 33240266