For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Explore the power of knock-out cell lines for your research

  1. Link

    mfsd2anls1-antibody-ab177881.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmission Receptors / Channels GPCR Adrenergic Receptors
Share by email

Anti-MFSD2A/NLS1 antibody (ab177881)

  • Datasheet
  • SDS
Reviews (1) Submit a question References (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-MFSD2A/NLS1 antibody (ab177881)
  • Western blot - Anti-MFSD2A/NLS1 antibody (ab177881)

Key features and details

  • Rabbit polyclonal to MFSD2A/NLS1
  • Suitable for: WB
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human MFSD2A/NLS1 protein (ab153557)
Primary
Product image
Alexa Fluor® 488 Anti-CD146 antibody [EPR3208] (ab196448)
Primary
Product image
Anti-SLC27A4 / FATP4 antibody [EPR17319-26] (ab200353)

View more associated products

Overview

  • Product name

    Anti-MFSD2A/NLS1 antibody
    See all MFSD2A/NLS1 primary antibodies
  • Description

    Rabbit polyclonal to MFSD2A/NLS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human MFSD2A/NLS1 aa 183-232. The exact sequence is proprietary.
    Sequence:

    MFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNSS


    Database link: Q8NA29
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Human thyroid tumor and lung tissue lysate.
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurotransmission
    • Receptors / Channels
    • GPCR
    • Adrenergic Receptors
    • Neuroscience
    • Neurotransmitter
    • Biogenic Amines
    • Adrenaline
    • Cancer
    • Oncoproteins/suppressors
    • Tumor suppressors
    • Other

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human MFSD2A/NLS1 protein (ab153557)
  • Related Products

    • Recombinant Human MFSD2A/NLS1 protein (ab153557)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab177881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 60, 50 kDa.
Notes
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 60, 50 kDa.

Target

  • Function

    Play a role in thermogenesis via beta-adrenergic signaling pathway.
  • Sequence similarities

    Belongs to the major facilitator superfamily.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Target information above from: UniProt accession Q8NA29 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 512633 Cow
    • Entrez Gene: 84879 Human
    • Entrez Gene: 76574 Mouse
    • Entrez Gene: 298504 Rat
    • Omim: 614397 Human
    • SwissProt: Q8NA29 Human
    • SwissProt: Q9DA75 Mouse
    • Unigene: 655177 Human
    • Unigene: 331842 Mouse
    see all
  • Alternative names

    • 1700018O18Rik antibody
    • FLJ14490 antibody
    • FLJ35904 antibody
    • Major facilitator superfamily domain containing 2 antibody
    • Major facilitator superfamily domain containing 2A antibody
    • Major facilitator superfamily domain-containing protein 2A antibody
    • MFS2A_HUMAN antibody
    • MFSD2 antibody
    • MFSD2A antibody
    • RGD1310174 antibody
    • RP23-121J14.3 antibody
    see all

Images

  • Western blot - Anti-MFSD2A/NLS1 antibody (ab177881)
    Western blot - Anti-MFSD2A/NLS1 antibody (ab177881)
    Anti-MFSD2A/NLS1 antibody (ab177881) at 1 µg/ml + Human thyroid tumour lysate at 10 µg

    Predicted band size: 60, 50 kDa



    Western blot analysis of human thyroid tumor lysate labeling MFSD2A/NLS1 with ab177881.

  • Western blot - Anti-MFSD2A/NLS1 antibody (ab177881)
    Western blot - Anti-MFSD2A/NLS1 antibody (ab177881)
    All lanes : Anti-MFSD2A/NLS1 antibody (ab177881) at 1 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : HepG2 cell lysate

    Lysates/proteins at 25 µg per lane.

    Predicted band size: 60, 50 kDa



    Western blot analysis labeling MFSD2A/NLS1 with ab177881.

Protocols

  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (3)

Publishing research using ab177881? Please let us know so that we can cite the reference in this datasheet.

ab177881 has been referenced in 3 publications.

  • Sánchez-Campillo M  et al. Child Head Circumference and Placental MFSD2a Expression Are Associated to the Level of MFSD2a in Maternal Blood During Pregnancy. Front Endocrinol (Lausanne) 11:38 (2020). PubMed: 32117064
  • James-Allan LB  et al. Changes in Placental Nutrient Transporter Protein Expression and Activity Across Gestation in Normal and Obese Women. Reprod Sci 27:1758-1769 (2020). PubMed: 32072607
  • Yang J  et al. Burns Impair Blood-Brain Barrier and Mesenchymal Stem Cells Can Reverse the Process in Mice. Front Immunol 11:578879 (2020). PubMed: 33240266

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Flow Cytometry abreview for Anti-MFSD2A/NLS1 antibody

Inconclusive
Abreviews
Abreviews
abreview image
Application
Flow Cytometry
Sample
Human Cell (BLOOD)
Permeabilization
No
Specification
BLOOD
Preparation
Cell harvesting/tissue preparation method: e identification of different blood cells subpopulation: monocytes, neutrophils , linf. T, and NK cells. Same samples were also stained with trial antibody: anti-MFSD2A (Abcam, Ref.: ab177881) previously conjugated to PE by following Abcam kit’s instructions.
Sample buffer: PBS+ serum bovin foetal
Fixation
Formaldehyde
Read More
The reviewer received a reward from Abcam’s Loyalty Program in thanks for submitting this Abreview and for helping the scientific community make better-informed decisions.

Ms. María Sánchez-Campillo

Verified customer

Submitted Mar 30 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.