Overview

  • Product name

    Anti-MGLUR8 antibody [4C1C1]
    See all MGLUR8 primary antibodies
  • Description

    Mouse monoclonal [4C1C1] to MGLUR8
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MGLUR8 aa 440-583. (Expressed in E.coli).
    Sequence:

    KELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITNKSTEYKVIG HWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCE RCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPW


    Database link: O00222

  • Positive control

    • WB: C6 cell lysate; MGLUR8 (aa 440-583)-hIgGFc transfected HEK-293 cell lysate; Human MGLUR8 (aa 440-583) recombinant protein. Flow Cyt: SK-N-SH cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    4C1C1
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 102 kDa.
Flow Cyt 1/200 - 1/400.

Target

Images

  • Anti-MGLUR8 antibody [4C1C1] (ab233791) at 1/500 dilution + Human MGLUR8 (aa 440-583) recombinant protein

    Predicted band size: 102 kDa



    Expected MW is 42.6 kDa.

  • All lanes : Anti-MGLUR8 antibody [4C1C1] (ab233791) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : MGLUR8 (aa 440-583)-hIgGFc transfected HEK-293 cell lysate

    Predicted band size: 102 kDa

  • Anti-MGLUR8 antibody [4C1C1] (ab233791) at 1/500 dilution + C6 (rat glial tumor cell line) cell lysate

    Predicted band size: 102 kDa

  • Flow cytometric analysis of SK-N-SH (human neuroblastoma cell line) cells labeling MGLUR8 with ab233791 at 1/200 dilution (green) compared with a negative control (red).

References

ab233791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up