Overview

  • Product name

  • Description

    Rabbit polyclonal to MGST1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Mouse MGST1 aa 8-155. N-terminal His-tag and GST-tag. Expressed in E. coli.
    Sequence:

    MDNEVLMAFTSYATIILTKMMFMSSATAFQRITNKVFANPEDCAGFGKGE NAKKFVRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALMHF RIFVGARIYHTIAYLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL


    Database link: Q91VS7

  • Positive control

    • WB: Recombinant mouse MGST1 protein. Rat liver tissue lysate. IHC-P: Mouse intestine, ovary, kidney and stomach tissue.
  • General notes

     This product was previously labelled as Microsomal Glutathione S-transferase 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 18 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a wide substrate specificity.
  • Tissue specificity

    Highly expressed in liver.
  • Sequence similarities

    Belongs to the MAPEG family.
  • Post-translational
    modifications

    Peroxynitrite induces nitration at Tyr-93 which activates the enzyme.
  • Cellular localization

    Microsome. Mitochondrion outer membrane. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGST1 antibody
    • Glutathione S transferase 12 antibody
    • GST12 antibody
    • MGST 1 antibody
    • MGST antibody
    • MGST I antibody
    • MGST1 antibody
    • MGST1_HUMAN antibody
    • Microsomal glutathione S-transferase 1 antibody
    • Microsomal GST 1 antibody
    • Microsomal GST-1 antibody
    • Microsomal GST-I antibody
    see all

Images

  • Anti-MGST1 antibody (ab231904) at 3 µg/ml + Rat liver tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 18 kDa
    Observed band size: 17 kDa
    why is the actual band size different from the predicted?

  • Formalin-fixed, paraffin-embedded mouse intestine tissue stained for MGST1 using ab231904 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse ovary tissue stained for MGST1 using ab231904 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for MGST1 using ab231904 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse stomach tissue stained for MGST1 using ab231904 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-MGST1 antibody (ab231904) at 3 µg/ml + MGST1

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 18 kDa
    Observed band size: 49 kDa why is the actual band size different from the predicted?

References

ab231904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up