Overview

  • Product name

  • Description

    Rabbit polyclonal to MGST2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MGST2 aa 31-63.
    Sequence:

    LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF


    Database link: Q99735

  • Positive control

    • WB: HepG2 cell lysate. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 17 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ27438 antibody
    • glutathione S transferase, microsomal, 2 antibody
    • GST 2 antibody
    • GST2 antibody
    • MGC14097 antibody
    • MGST 2 antibody
    • MGST II antibody
    • MGST2 antibody
    • MGST2_HUMAN antibody
    • MGSTII antibody
    • Microsomal glutathione S transferase 2 antibody
    • Microsomal glutathione S-transferase 2 antibody
    • Microsomal GST 2 antibody
    • Microsomal GST II antibody
    see all

Images

  • Anti-MGST2 antibody (ab224359) at 1/100 dilution + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 17 kDa

  • Paraffin-embedded human liver tissue stained for MGST2 using ab224359 at 1/200 dilution in immunohistochemical analysis.

References

ab224359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up