Overview

  • Product name

  • Description

    Rabbit polyclonal to mH2A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human mH2A1 aa 109-369. N-terminal His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    IHPELLAKKRGSKGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKS KKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLQVVQADIASID SDAVVHPTNTDFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAA VSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAF PSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGI YVQEMAKLDAN


    Database link: O75367-2

  • Positive control

    • WB: Recombinant human mH2A1 protein; Human lung lysate; Pig heart lysate. IHC-P: Human kidney, pancreatic cancer, skin cancer, colorectal cancer and breast cancer tissue.
  • General notes

    Previously labelled as macroH2A.1.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 40 kDa.

Target

  • Function

    Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Involved in stable X chromosome inactivation. Inhibits the binding of transcription factors and interferes with the activity of remodeling SWI/SNF complexes. Inhibits histone acetylation by EP300 and recruits class I HDACs, which induces an hypoacetylated state of chromatin. In addition, isoform 1, but not isoform 2, binds ADP-ribose and O-acetyl-ADP-ribose, and may be involved in ADP-ribose-mediated chromatin modulation.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 histone H2A domain.
    Contains 1 Macro domain.
  • Post-translational
    modifications

    Monoubiquitinated at either Lys-116 or Lys-117. May also be polyubiquitinated. Ubiquitination is mediated by the CUL3/SPOP E3 complex and does not promote proteasomal degradation. Instead, it is required for enrichment in inactive X chromosome chromatin.
  • Cellular localization

    Nucleus. Chromosome. Enriched in inactive X chromosome chromatin and in senescence-associated heterochromatin.
  • Information by UniProt
  • Database links

  • Alternative names

    • Core histone macro h2a.1 antibody
    • Core histone macro-H2A.1 antibody
    • H2A histone family member Y antibody
    • H2A.y antibody
    • H2A/y antibody
    • H2AF12M antibody
    • H2AFJ antibody
    • H2afy antibody
    • H2AY_HUMAN antibody
    • Histone H2A.Y antibody
    • Histone macroH2A1 antibody
    • Histone macroH2A1.1 antibody
    • Histone macroH2A1.2 antibody
    • Macroh2a1 antibody
    • MACROH2A1.1 antibody
    • MacroH2A1.2 antibody
    • Medulloblastoma antigen MU MB 50.205 antibody
    • Medulloblastoma antigen MU-MB-50.205 antibody
    • mH2a antibody
    • mH2A1 antibody
    see all

Images

  • All lanes : Anti-mH2A1 antibody (ab232960) at 2 µg/ml

    Lane 1 : Human lung lysate
    Lane 2 : Pig heart lysate

    Predicted band size: 40 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for mH2A1 using ab232960 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for mH2A1 using ab232960 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for mH2A1 using ab232960 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human colorectal cancer tissue stained for mH2A1 using ab232960 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for mH2A1 using ab232960 at 10 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-mH2A1 antibody (ab232960) at 2 µg/ml + Recombinant human mH2A1 protein

    Predicted band size: 40 kDa

References

ab232960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up