Overview

  • Product name

  • Description

    Rabbit polyclonal to mH2A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human mH2A2 aa 185-255.
    Sequence:

    ILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALE KAGGKEFLETVKELRKSQGPL


    Database link: Q9P0M6

  • Positive control

    • WB: SH-SY5Y, NIH/3T3 and |NBT-II whole cell lysates. IHC-P: Human cerebellum, endometrium and testis tissue. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab246995 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 40 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in stable X chromosome inactivation.
  • Sequence similarities

    Contains 1 histone H2A domain.
    Contains 1 Macro domain.
  • Cellular localization

    Nucleus. Chromosome. Enriched in inactive X chromosome chromatin and in senescence-associated heterochromatin.
  • Information by UniProt
  • Database links

  • Alternative names

    • Core histone macro H2A2.2 antibody
    • Core histone macro-H2A.2 antibody
    • Core histone macroH2A2.2 antibody
    • H2A histone family member Y2 antibody
    • H2AFY2 antibody
    • H2AW_HUMAN antibody
    • Histone macroH2A2 antibody
    • Macro H2A.2 antibody
    • Macro H2A2 antibody
    • MacroH2A.2 antibody
    • MacroH2A2 antibody
    • mH2A2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for mH2A2 (green) using ab246995 at 4 μg/ml in ICC/IF.

  • Paraffin-embedded human cerebellum tissue stained for mH2A2 using ab246995 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human endometrium tissue stained for mH2A2 using ab246995 at 1/500 dilution in immunohistochemical analysis.
  • Paraffin-embedded human testis tissue stained for mH2A2 using ab246995 at 1/500 dilution in immunohistochemical analysis.
  • Anti-mH2A2 antibody (ab246995) at 0.4 µg + SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate

    Predicted band size: 40 kDa

  • All lanes : Anti-mH2A2 antibody (ab246995) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 2 : NBT-II (rat Wistar bladder tumor cell line) whole cell lysate

    Predicted band size: 40 kDa

References

ab246995 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246995.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up