Anti-MIA3/TANGO1 antibody (ab244511)
Key features and details
- Rabbit polyclonal to MIA3/TANGO1
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MIA3/TANGO1 antibody
See all MIA3/TANGO1 primary antibodies -
Description
Rabbit polyclonal to MIA3/TANGO1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MIA3/TANGO1 aa 316-398.
Sequence:LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEGLGG AMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVI
Database link: Q5JRA6 -
Positive control
- IHC-P: Human testis tissue. ICC/IF: U-251 MG cells.
-
General notes
This product was previously labelled as MIA3
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244511 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Required for collagen VII (COL7A1) secretion by loading COL7A1 into transport carriers. May participate in cargo loading of COL7A1 at endoplasmic reticulum exit sites by binding to COPII coat subunits Sec23/24 and guiding SH3-bound COL7A1 into a growing carrier. Does not play a role in global protein secretion and is apparently specific to COL7A1 cargo loading. However, it may participate in secretion of other proteins in cells that do not secrete COL7A1. -
Tissue specificity
Broadly expressed, except in bone marrow and peripheral blood mononuclear cells. Down-regulated in melanoma tissue. -
Sequence similarities
Belongs to the MIA/OTOR family. Tango1 subfamily.
Contains 1 SH3 domain. -
Domain
The proline-rich region (PRD) mediates the interaction with COPII coat subunits Sec23/24.
Although 2 transmembrane domains are predicted, PubMed:19269366 showed that it only contains one transmembrane domain. The other predicted transmembrane region is probably a hairpin-type region embedded into the membrane, which does not cross the membrane. It is unclear which of the 2 predicted transmembrane regions is the transmembrane or the hairpin-type region. -
Cellular localization
Endoplasmic reticulum membrane. Localizes at endoplasmic reticulum exit sites. After loading of COL7A1 into transport carriers, it is not incorporated into COPII carriers and remains in the endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 375056 Human
- Omim: 613455 Human
- SwissProt: Q5JRA6 Human
- Unigene: 118474 Human
-
Alternative names
- ARNT antibody
- C219 reactive peptide antibody
- C219-reactive peptide antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for MIA3/TANGO1 (green) using ab244511 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIA3/TANGO1 antibody (ab244511)
Paraffin-embedded human testis tissue stained for MIA3/TANGO1 using ab244511 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIA3/TANGO1 antibody (ab244511)
Paraffin-embedded human skeletal muscle tissue stained for MIA3/TANGO1 using ab244511 at 1/200 dilution in immunohistochemical analysis. Low expression, as expected.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244511 has not yet been referenced specifically in any publications.