Anti-MIA3/TANGO1 antibody (ab244511)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MIA3/TANGO1 antibody
See all MIA3/TANGO1 primary antibodies -
Description
Rabbit polyclonal to MIA3/TANGO1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human MIA3/TANGO1 aa 316-398.
Sequence:LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEGLGG AMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVI
Database link: Q5JRA6 -
Positive control
- IHC-P: Human testis tissue. ICC/IF: U-251 MG cells.
-
General notes
This product was previously labelled as MIA3
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244511 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Required for collagen VII (COL7A1) secretion by loading COL7A1 into transport carriers. May participate in cargo loading of COL7A1 at endoplasmic reticulum exit sites by binding to COPII coat subunits Sec23/24 and guiding SH3-bound COL7A1 into a growing carrier. Does not play a role in global protein secretion and is apparently specific to COL7A1 cargo loading. However, it may participate in secretion of other proteins in cells that do not secrete COL7A1. -
Tissue specificity
Broadly expressed, except in bone marrow and peripheral blood mononuclear cells. Down-regulated in melanoma tissue. -
Sequence similarities
Belongs to the MIA/OTOR family. Tango1 subfamily.
Contains 1 SH3 domain. -
Domain
The proline-rich region (PRD) mediates the interaction with COPII coat subunits Sec23/24.
Although 2 transmembrane domains are predicted, PubMed:19269366 showed that it only contains one transmembrane domain. The other predicted transmembrane region is probably a hairpin-type region embedded into the membrane, which does not cross the membrane. It is unclear which of the 2 predicted transmembrane regions is the transmembrane or the hairpin-type region. -
Cellular localization
Endoplasmic reticulum membrane. Localizes at endoplasmic reticulum exit sites. After loading of COL7A1 into transport carriers, it is not incorporated into COPII carriers and remains in the endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 375056 Human
- Omim: 613455 Human
- SwissProt: Q5JRA6 Human
- Unigene: 118474 Human
-
Alternative names
- ARNT antibody
- C219 reactive peptide antibody
- C219-reactive peptide antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-MIA3/TANGO1 antibody (ab244511)PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for MIA3/TANGO1 (green) using ab244511 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIA3/TANGO1 antibody (ab244511)Paraffin-embedded human testis tissue stained for MIA3/TANGO1 using ab244511 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIA3/TANGO1 antibody (ab244511)Paraffin-embedded human skeletal muscle tissue stained for MIA3/TANGO1 using ab244511 at 1/200 dilution in immunohistochemical analysis. Low expression, as expected.
Datasheets and documents
References
ab244511 has not yet been referenced specifically in any publications.
