Anti-MIC19 antibody (ab224565)
Key features and details
- Rabbit polyclonal to MIC19
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-MIC19 antibody
See all MIC19 primary antibodies -
Description
Rabbit polyclonal to MIC19 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment corresponding to Human MIC19 aa 15-89.
Sequence:DENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKR RVAEELALEQAKKESEDQKRLKQAK
Database link: Q9NX63 -
Positive control
- IHC-P: Human stomach, kidney, duodenum, skeletal muscle and liver tissue. ICC/IF: U-2 OS cells. WB: HEK-293, NIH/3T3 and NBT-II cell lysates.
-
General notes
This product was previously labelled as CHCHD3
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224565 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 26 kDa. | |
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Required for maintenance of mitochondrial crista integrity and mitochondrial function. May act as a scaffolding protein that stabilizes protein complexes involved in crista architecture and protein import. Has also been shown to function as a transcription factor which binds to the BAG1 promoter and represses BAG1 transcription. -
Tissue specificity
Detected at low levels in brain, placenta, lung, liver, kidney and pancreas with increased levels in heart and skeletal muscle. Higher expression in primary lung cancers than in normal lung tissue. -
Sequence similarities
Contains 1 CHCH domain. -
Cellular localization
Mitochondrion inner membrane. Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 616477 Cow
- Entrez Gene: 54927 Human
- Entrez Gene: 66075 Mouse
- Entrez Gene: 296966 Rat
- Omim: 613748 Human
- SwissProt: Q5E9D3 Cow
- SwissProt: Q9NX63 Human
- SwissProt: Q9CRB9 Mouse
see all -
Alternative names
- CHCH3_HUMAN antibody
- CHCHD 3 antibody
- Chchd3 antibody
see all
Images
-
Anti-MIC19 antibody (ab224565) at 1/100 dilution + HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
Developed using the ECL technique.
Predicted band size: 26 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIC19 antibody (ab224565)
Immunohistochemical analysis of human duodenum tissue labelling MIC19 with ab224565 at 1/500 dilution.
-
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for MIC19 (green) using ab224565 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIC19 antibody (ab224565)
Immunohistochemical analysis of human kidney tissue labelling MIC19 with ab224565 at 1/500 dilution.
-
All lanes : Anti-MIC19 antibody (ab224565) at 0.4 µg/ml
Lane 1 : U-87MG ATCC cells transfected with control siRNA
Lanes 2-3 : U-87MG ATCC cells transfected with target specific siRNA probe
Predicted band size: 26 kDaLoading control: anti- GAPDH
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIC19 antibody (ab224565)
Immunohistochemical analysis of human skeletal muscle tissue labelling MIC19 with ab224565 at 1/500 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIC19 antibody (ab224565)
Immunohistochemical analysis of human liver tissue labelling MIC19 with ab224565 at 1/500 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIC19 antibody (ab224565)
Paraffin-embedded human stomach lower tissue stained for MIC19 using ab224565 at 1/500 dilution in immunohistochemical analysis.
-
All lanes : Anti-MIC19 antibody (ab224565) at 1/100 dilution
Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
Lane 2 : NBT-II cell lysate
Developed using the ECL technique.
Predicted band size: 26 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224565 has not yet been referenced specifically in any publications.