Anti-MIC19 antibody (ab224565)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MIC19 antibody
See all MIC19 primary antibodies -
Description
Rabbit polyclonal to MIC19 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow
-
Immunogen
Recombinant fragment corresponding to Human MIC19 aa 15-89.
Sequence:DENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKR RVAEELALEQAKKESEDQKRLKQAK
Database link: Q9NX63 -
Positive control
- IHC-P: Human stomach, kidney, duodenum, skeletal muscle and liver tissue. ICC/IF: U-2 OS cells. WB: HEK-293, NIH/3T3 and NBT-II cell lysates.
-
General notes
This product was previously labelled as CHCHD3
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224565 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| WB | 1/100 - 1/250. Predicted molecular weight: 26 kDa. | |
| IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Required for maintenance of mitochondrial crista integrity and mitochondrial function. May act as a scaffolding protein that stabilizes protein complexes involved in crista architecture and protein import. Has also been shown to function as a transcription factor which binds to the BAG1 promoter and represses BAG1 transcription. -
Tissue specificity
Detected at low levels in brain, placenta, lung, liver, kidney and pancreas with increased levels in heart and skeletal muscle. Higher expression in primary lung cancers than in normal lung tissue. -
Sequence similarities
Contains 1 CHCH domain. -
Cellular localization
Mitochondrion inner membrane. Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 616477 Cow
- Entrez Gene: 54927 Human
- Entrez Gene: 66075 Mouse
- Entrez Gene: 296966 Rat
- Omim: 613748 Human
- SwissProt: Q5E9D3 Cow
- SwissProt: Q9NX63 Human
- SwissProt: Q9CRB9 Mouse
see all -
Alternative names
- CHCH3_HUMAN antibody
- CHCHD 3 antibody
- Chchd3 antibody
see all
Images
-
Western blot - Anti-MIC19 antibody (ab224565)Anti-MIC19 antibody (ab224565) at 1/100 dilution + HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
Developed using the ECL technique.
Predicted band size: 26 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIC19 antibody (ab224565)Immunohistochemical analysis of human duodenum tissue labelling MIC19 with ab224565 at 1/500 dilution.
-
Immunocytochemistry/ Immunofluorescence - Anti-MIC19 antibody (ab224565)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for MIC19 (green) using ab224565 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIC19 antibody (ab224565)Immunohistochemical analysis of human kidney tissue labelling MIC19 with ab224565 at 1/500 dilution.
-
Western blot - Anti-MIC19 antibody (ab224565)All lanes : Anti-MIC19 antibody (ab224565) at 0.4 µg/ml
Lane 1 : U-87MG ATCC cells transfected with control siRNA
Lanes 2-3 : U-87MG ATCC cells transfected with target specific siRNA probe
Predicted band size: 26 kDaLoading control: anti- GAPDH
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIC19 antibody (ab224565)Immunohistochemical analysis of human skeletal muscle tissue labelling MIC19 with ab224565 at 1/500 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIC19 antibody (ab224565)Immunohistochemical analysis of human liver tissue labelling MIC19 with ab224565 at 1/500 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-MIC19 antibody (ab224565)Paraffin-embedded human stomach lower tissue stained for MIC19 using ab224565 at 1/500 dilution in immunohistochemical analysis.
-
Western blot - Anti-MIC19 antibody (ab224565)All lanes : Anti-MIC19 antibody (ab224565) at 1/100 dilution
Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) cell lysate
Lane 2 : NBT-II cell lysate
Developed using the ECL technique.
Predicted band size: 26 kDa
Datasheets and documents
References
ab224565 has not yet been referenced specifically in any publications.
