Overview

  • Product name

  • Description

    Rabbit polyclonal to MIC19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human MIC19 aa 35-84 (N terminal).
    Sequence:

    RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR


    Database link: NP_060282

  • Positive control

    • Hela cell lysate
  • General notes

     This product was previously labelled as CHCHD3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab98975 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Required for maintenance of mitochondrial crista integrity and mitochondrial function. May act as a scaffolding protein that stabilizes protein complexes involved in crista architecture and protein import. Has also been shown to function as a transcription factor which binds to the BAG1 promoter and represses BAG1 transcription.
  • Tissue specificity

    Detected at low levels in brain, placenta, lung, liver, kidney and pancreas with increased levels in heart and skeletal muscle. Higher expression in primary lung cancers than in normal lung tissue.
  • Sequence similarities

    Contains 1 CHCH domain.
  • Cellular localization

    Mitochondrion inner membrane. Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CHCH3_HUMAN antibody
    • CHCHD 3 antibody
    • Chchd3 antibody
    • Coiled coil helix coiled coil helix domain containing 3 antibody
    • Coiled coil helix coiled coil helix domain containing protein 3 mitochondrial antibody
    • Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 antibody
    • FLJ20420 antibody
    • MINOS3 antibody
    • mitochondrial antibody
    • Mitochondrial inner membrane organizing system 3 antibody
    • PPP1R22 antibody
    • Protein phosphatase 1 regulatory subunit 22 antibody
    see all

Images

  • Anti-MIC19 antibody (ab98975) at 1 µg/ml + Hela cell lysate at 10 µg

    Predicted band size: 26 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Thapa D  et al. Transgenic overexpression of mitofilin attenuates diabetes mellitus-associated cardiac and mitochondria dysfunction. J Mol Cell Cardiol 79:212-23 (2015). Read more (PubMed: 25463274) »
  • Ott C  et al. Sam50 functions in mitochondrial intermembrane space bridging and biogenesis of respiratory complexes. Mol Cell Biol 32:1173-88 (2012). WB . Read more (PubMed: 22252321) »
See all 3 Publications for this product

Customer reviews and Q&As

Answer

Thank you for contacting us.

Regarding antibodies ab79397 and ab32577, they both have been tested in IHC with paraffin embedded sections in the species stated on the datasheet. We don’t have preliminary data using them with frozen sections, but they are very likely to react in such conditions.

Ab48139 has recently been validated to use in IHC-P in Canine, Feline, Mouse, Rat and Human.

As for ab81127, ab83015 and ab98975, unfortunately, we have not characterised them by IHC, it doesn’t mean they won’t work in this application, but we don’t have data to support it.

At Abcam we have an antibody evaluation system, called Abreview, by which customers interested in testing an antibody in new species or applications (not yet tested) can benefit from a free primary antibody in their next purchase if they share the results with us, publishing them in our website.

To participate in this system, customers should first let us know the antibody they want to test in the new species/ applications. We then issue the discount code valid for one free primary antibody. This code must be issued before purchasing the antibody. The customer then purchases the antibody normally, and tests it in the new species / applications.

Once we receive the results in our Website as an Abreview, the discount code becomes active, and it can be redeemed for any primary antibody ordered within the next 4 months.

As mentioned, the discount code might be issued before the purchase of the antibody, but, as an exceptional case, I can still send a discount code if you would like to test any of these antibodies (ab81127, ab83015 and ab98975) with IHC and share your results with us.

To find out more about our Abreview system, please visit: https://www.abcam.com/abreviews.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: http://it.adminsite.com/admin/crm2/www.abcam.com/collaborationdiscount.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up