Overview

  • Product name

  • Description

    Rabbit polyclonal to MICS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human MICS1 aa 293-345.
    Sequence:

    YDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGN RKK


    Database link: Q9H3K2

  • Positive control

    • WB: Rat brain tissue lysate. IHC-P: Human brain and pancreatic cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/100 - 1/500.
ICC/IF 1/50 - 1/500.

Target

  • Function

    Required for the mitochondrial tubular network and cristae organization. Involved in apoptotic release of cytochrome c.
  • Sequence similarities

    Belongs to the BI1 family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dermal papilla derived protein 2 antibody
    • Dermal papilla-derived protein 2 antibody
    • DERP2 antibody
    • Ghitm antibody
    • GHITM_HUMAN antibody
    • Growth hormone inducible transmembrane protein antibody
    • Growth hormone-inducible transmembrane protein antibody
    • HSPC282 antibody
    • MICS1 antibody
    • Mitochondrial morphology and cristae structure 1 antibody
    • My021 antibody
    • PTD010 antibody
    • TMBIM5 antibody
    • Transmembrane BAX inhibitor motif containing 5 antibody
    • Transmembrane BAX inhibitor motif containing protein 5 antibody
    • Transmembrane BAX inhibitor motif-containing protein 5 antibody
    see all

Images

  • Anti-MICS1 antibody (ab236967) at 1/500 dilution + Rat brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human brain tissue stained for MICS1 using ab236967 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human pancreatic cancer tissue stained for MICS1 using ab236967 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for MICS1 (Green) using ab236967 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab236967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up