Overview

  • Product name

  • Description

    Rabbit polyclonal to MICU1
  • Host species

    Rabbit
  • Specificity

    This antibody is expected to recognize isoform 3.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human MICU1 aa 210-259 (C terminal).
    Sequence:

    LSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLM


    Database link: NP_001182448.1

  • Positive control

    • MCF7 cell lysate.
  • General notes

     This product was previously labelled as CBARA1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab135358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa.

Target

Images

  • Anti-MICU1 antibody (ab135358) at 1 µg/ml + MCF7 cell lysate at 10 µg

    Predicted band size: 32 kDa

References

ab135358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up