Overview

  • Product name

  • Description

    Rabbit polyclonal to MICU1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey, Giant Panda
  • Immunogen

    Recombinant fragment corresponding to Human MICU1 aa 287-371.
    Sequence:

    LKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSG VQSKKLTAMQRQLKKHFKEGKGLTFQEVENFFTFL


    Database link: Q9BPX6

  • Positive control

    • IHC-P: Human adrenal gland tissue.
  • General notes

     This product was previously labelled as CBARA1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Key regulator of mitochondrial calcium uptake required for calcium entry into mitochondrion. May act as a calcium sensor via its EF-hand domains, gating the activity of a calcium channel partner. Induces T-helper 1-mediated autoreactivity, which is accompanied by the release of IFNG.
  • Tissue specificity

    Expressed in epithelial cell line. Strongly expressed in epidermal keratinocytes and dermal endothelial cells.
  • Sequence similarities

    Belongs to the MICU1 family.
    Contains 2 EF-hand domains.
  • Domain

    The EF-hand domains are required for mitochondrial calcium homeostasis function.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Allergen Hom s 4 antibody
    • ara CALC antibody
    • atopy related autoantigen antibody
    • atopy related autoantigen CALC antibody
    • Atopy-related autoantigen CALC antibody
    • CALC antibody
    • calcium binding atopy related autoantigen 1 antibody
    • Calcium uptake protein 1 antibody
    • calcium uptake protein 1, mitochondrial antibody
    • Calcium-binding atopy-related autoantigen 1 antibody
    • CBARA1 antibody
    • EFHA3 antibody
    • FLJ12684 antibody
    • MICU1 antibody
    • MICU1_HUMAN antibody
    • mitochondrial antibody
    • mitochondrial calcium uptake 1 antibody
    • MPXPS antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for MICU1 using ab224161 at 1/50 dilution in immunohistochemical analysis.

References

ab224161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up