Overview

  • Product name

  • Description

    Rabbit polyclonal to MID1IP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MID1IP1 aa 62-136.
    Sequence:

    CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPP PAGSEEGSAWKSKDILVDLGHLEGA


    Database link: Q9NPA3

  • Positive control

    • WB: RT4 cell lysate. IHC-P: Human small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224550 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 20 kDa.

Target

  • Function

    Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules.
  • Sequence similarities

    Belongs to the SPOT14 family.
  • Cellular localization

    Nucleus. Cytoplasm. Cytoplasm, cytoskeleton. Associated with microtubules.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3110038L01Rik antibody
    • FLJ10386 antibody
    • G12 like antibody
    • Gastrulation specific G12 like protein antibody
    • Gastrulation-specific G12-like protein antibody
    • M1IP1_HUMAN antibody
    • MGC72582 antibody
    • MID1 interacting G12 like protein antibody
    • MID1 interacting protein 1 (gastrulation specific G12 like) antibody
    • Mid1-interacting G12-like protein antibody
    • Mid1-interacting protein 1 antibody
    • Mid1ip1 antibody
    • MIG12 antibody
    • OTTMUSP00000018143 antibody
    • OTTMUSP00000018222 antibody
    • OTTMUSP00000018284 antibody
    • OTTMUSP00000018285 antibody
    • Protein STRAIT11499 antibody
    • Protein STRAIT11499 homolog antibody
    • RP23-130J1.1 antibody
    • S14R antibody
    • Slap antibody
    • Spot 14 like androgen inducible protein antibody
    • Spot 14 related protein antibody
    • Spot 14-R antibody
    • Spot 14-related protein antibody
    • STRAIT11499 antibody
    • THRSPL antibody
    see all

Images

  • Anti-MID1IP1 antibody (ab224550) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 20 kDa

  • Paraffin-embedded human small intestine tissue stained for MID1IP1 using ab224550 at 1/50 dilution in immunohistochemical analysis.

References

ab224550 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224550.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up