Overview

  • Product name

    Anti-MIEF2 antibody - N-terminal
    See all MIEF2 primary antibodies
  • Description

    Rabbit polyclonal to MIEF2 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Horse
  • Immunogen

    Synthetic peptide within Human MIEF2 aa 15-64 (N terminal). The exact sequence is proprietary. (NP_683684).
    Sequence:

    FSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDR


    Database link: Q96C03-3

  • Positive control

    • HT1080 whole cell lysate.
  • General notes

     This product was previously labelled as SMCR7

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa.

Target

  • Function

    Mitochondrial outer membrane protein which regulates mitochondrial fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins. Regulates DNM1L GTPase activity.
  • Tissue specificity

    Expressed in all tissues tested with highest expression in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the MID49/MID51 family.
  • Cellular localization

    Mitochondrion outer membrane. Colocalizes with DNM1L at mitochondrial membrane. Forms foci and rings around mitochondria.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC23130 antibody
    • MID49 antibody
    • MID49_HUMAN antibody
    • MIEF2 antibody
    • Mitochondrial dynamic protein MID49 antibody
    • Mitochondrial dynamic protein of 49 kDa antibody
    • Mitochondrial dynamics protein MID49 antibody
    • Mitochondrial dynamics protein of 49 kDa antibody
    • Mitochondrial elongation factor 2 antibody
    • Smith Magenis syndrome chromosome region candidate 7 antibody
    • Smith-Magenis syndrome chromosomal region candidate gene 7 protein antibody
    see all

Images

  • All lanes : Anti-MIEF2 antibody - N-terminal (ab182535) at 3 µg/ml

    Lane 1 : Marker
    Lane 2 : HepG2 lysate
    Lane 3 : Jurkat lysate
    Lane 4 : MCF7 lysate
    Lane 5 : DLD1 lysate
    Lane 6 : HeLa lysate
    Lane 7 : HCT116 lysate
    Lane 8 : Hek293 lysate

    Predicted band size: 50 kDa

  • Anti-MIEF2 antibody - N-terminal (ab182535) at 1 µg/ml + HT1080 whole cell lysate at 10 µg

    Predicted band size: 50 kDa

References

ab182535 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up