Anti-MIEF2 antibody - N-terminal (ab182535)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-MIEF2 antibody - N-terminal
See all MIEF2 primary antibodies -
Description
Rabbit polyclonal to MIEF2 - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Horse -
Immunogen
Synthetic peptide within Human MIEF2 aa 15-64 (N terminal). The exact sequence is proprietary. (NP_683684).
Sequence:FSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDR
Database link: Q96C03-3 -
Positive control
- HT1080 whole cell lysate.
-
General notes
This product was previously labelled as SMCR7
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 2% Sucrose, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab182535 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. |
Target
-
Function
Mitochondrial outer membrane protein which regulates mitochondrial fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins. Regulates DNM1L GTPase activity. -
Tissue specificity
Expressed in all tissues tested with highest expression in heart and skeletal muscle. -
Sequence similarities
Belongs to the MID49/MID51 family. -
Cellular localization
Mitochondrion outer membrane. Colocalizes with DNM1L at mitochondrial membrane. Forms foci and rings around mitochondria. - Information by UniProt
-
Database links
- Entrez Gene: 125170 Human
- SwissProt: Q96C03 Human
- Unigene: 655555 Human
-
Alternative names
- MGC23130 antibody
- MID49 antibody
- MID49_HUMAN antibody
see all
Images
-
All lanes : Anti-MIEF2 antibody - N-terminal (ab182535) at 3 µg/ml
Lane 1 : Marker
Lane 2 : HepG2 lysate
Lane 3 : Jurkat lysate
Lane 4 : MCF7 lysate
Lane 5 : DLD1 lysate
Lane 6 : HeLa lysate
Lane 7 : HCT116 lysate
Lane 8 : Hek293 lysate
Predicted band size: 50 kDa -
Anti-MIEF2 antibody - N-terminal (ab182535) at 1 µg/ml + HT1080 whole cell lysate at 10 µg
Predicted band size: 50 kDa
Protocols
Datasheets and documents
References
ab182535 has not yet been referenced specifically in any publications.