Overview

  • Product name

    Anti-MIER2 antibody
  • Description

    Rabbit polyclonal to MIER2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MIER2 aa 1-545.
    Sequence:

    MAEASSLGRQSPRVVSCLEHSLCPGEPGLQTTAVVSMGSGDHQFNLAEIL SQNYSVRGECEEASRCPDKPKEELEKDFISQSNDMPFDELLALYGYEASD PISDRESEGGDVAPNLPDMTLDKEQIAKDLLSGEEEEETQSSADDLTPSV TSHEASDLFPNRSGSRFLADEDREPGSSASSDTEEDSLPANKCKKEIMVG PQFQADLSNLHLNRHCEKIYENEDQLLWDPSVLPEREVEEFLYRAVKRRW HEMAGPQLPEGEAVKDSEQALYELVKCNFNVEEALRRLRFNVKVIRDGLC AWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERY DYFAQQTRLGRRKYVPSGTTDADQDLDGSDPDGPGRPRPEQDTLTGMRTD PLSVDGTAGGLDEPGVASDGLPSSEPGPCSFQQLDESPAVPLSHRPPALA DPASYQPAVTAPEPDASPRLAVDFALPKELPLISSHVDLSGDPEETVAPA QVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMTC


    Database link: Q8N344

  • Positive control

    • WB: Jurkat, HepG2 and A549 whole cell lysate. IHC-P: Human liver and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000.

Target

  • Function

    Transcriptional repressor.
  • Sequence similarities

    Contains 1 ELM2 domain.
    Contains 1 SANT domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA1193 antibody
    • mesoderm induction early response 1, family member 2 antibody
    • Mesoderm induction early response protein 2 antibody
    • Mi-er2 antibody
    • Mier2 antibody
    • MIER2_HUMAN antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for MIER2 using ab235410 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-MIER2 antibody (ab235410) at 1/500 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human liver tissue stained for MIER2 using ab235410 at 1/100 dilution in immunohistochemical analysis.

References

ab235410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up