Overview

  • Product name
    Anti-Milk Fat Globule 1 antibody
    See all Milk Fat Globule 1 primary antibodies
  • Description
    Rabbit polyclonal to Milk Fat Globule 1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Milk Fat Globule 1 aa 1-387.
    Sequence:

    MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVF PSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQH WVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLA SHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPV EAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASS SYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVT GIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDN HSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

  • Positive control
    • Human Milk Fat Globule 1 transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab168733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.

Target

  • Function
    Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization (By similarity). Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Binds specifically to rotavirus and inhibits its replication.
    Medin is the main constituent of aortic medial amyloid.
  • Tissue specificity
    Mammary epithelial cell surfaces and aortic media. Overexpressed in several carcinomas.
  • Sequence similarities
    Contains 1 EGF-like domain.
    Contains 2 F5/8 type C domains.
  • Post-translational
    modifications
    Medin has a ragged N-terminus with minor species starting at Pro-264 and Gly-273.
  • Cellular localization
    Membrane. Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • BA46 antibody
    • Breast epithelial antigen BA46 antibody
    • EDIL1 antibody
    • HMFG antibody
    • hP47 antibody
    • HsT19888 antibody
    • Lactadherin antibody
    • Medin antibody
    • MFG-E8 antibody
    • MFGE8 antibody
    • MFGM antibody
    • MFGM_HUMAN antibody
    • Milk fat globule EGF factor 8 antibody
    • Milk fat globule EGF factor 8 protein antibody
    • Milk fat globule-EGF factor 8 antibody
    • O acetyl disialoganglioside synthase antibody
    • OAcGD3S antibody
    • SED1 antibody
    • SPAG10 antibody
    • Sperm associated antigen 10 antibody
    • Sperm surface protein hP47 antibody
    see all

Images

  • All lanes : Anti-Milk Fat Globule 1 antibody (ab168733) at 1 µg/ml

    Lane 1 : Human Milk Fat Globule 1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated secondary antibody at 1/2500 dilution

    Predicted band size: 43 kDa

References

ab168733 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168733.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up