Overview

  • Product name

  • Description

    Rabbit polyclonal to MINPP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MINPP1 aa 83-206.
    Sequence:

    LVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALA DWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITS SKHRCMDSSAAFLQGLWQHYHPGL


    Database link: Q9UNW1

  • Positive control

    • WB: RT4 cell lysate. IHC-P: Human pancreas tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 55 kDa.

Target

  • Function

    Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6) (By similarity). May play a role in bone development (endochondral ossification).
  • Tissue specificity

    Widely expressed with highest levels in kidney, liver and placenta.
  • Involvement in disease

    Note=Defects in MINPP1 may be involved in follicular thyroid tumors development.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3 antibody
    • 4 antibody
    • 5)-tetrakisphosphate 3-phosphatase antibody
    • 5)P(4) 3-phosphatase antibody
    • DKFZp564L2016 antibody
    • HIPER1 antibody
    • Inositol (1 antibody
    • inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase antibody
    • Ins(1 antibody
    • ins(1,3,4,5)P(4) 3-phosphatase antibody
    • MINP1_HUMAN antibody
    • Minpp1 antibody
    • MINPP2 antibody
    • MIPP antibody
    • Multiple inositol polyphosphate histidine phosphatase, 1 antibody
    • Multiple inositol polyphosphate phosphatase 1 antibody
    • multiple inositol polyphosphate phosphatase 2 antibody
    see all

Images

  • Anti-MINPP1 antibody (ab224473) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 55 kDa

  • Paraffin-embedded human pancreas tissue stained for MINPP1 with ab224473  at 1/50 dilution in immunohistochemical analysis.

References

ab224473 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up