Overview

  • Product name

  • Description

    Rabbit polyclonal to MIOX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human MIOX aa 1-285.
    Sequence:

    MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTH QTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAF QTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRP QASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQ VMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFN KFDLYTKCPDLPDVDKLRPYYQGLIDKYCPGILSW


    Database link: Q9UGB7

  • Positive control

    • WB: Mouse kidney lysate. IP: Mouse kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab235088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 33 kDa.
IP 1/200 - 1/2000.

Target

Images

  • Anti-MIOX antibody (ab235088) at 1/1000 dilution + Mouse kidney lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 33 kDa

  • MIOX was immunoprecipitated from 500 µg mouse kidney lysate with ab222887 at 1/200 dilution. 

    Lane 1: Rabbit control IgG IP in mouse kidney lysate.

    Lane 2: ab235088 IP in mouse kidney lysate.

    Lane 3: Mouse kidney lysate 10 µg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab235088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up