Description

  • Product name

  • Expression system

    Synthetic
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Synthetic
    • Species

      Human
    • Sequence

      GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLC APPDQPWVERIIQRLQRTSAKMKRRSS
    • Predicted molecular weight

      9 kDa
    • Amino acids

      22 to 98
  • Description

    Synthetic Human MIP-3 beta/CCL19 protein

Specifications

Our Abpromise guarantee covers the use of ab175155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Macrophage Inflammatory Protein 3 beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    It is recommended vials be centrifuged prior to opening. Water can be used to prepare stock solutions of 20 µmol/L. Stock solutions with up to 30% DMSO/water can also be prepared.

General Info

  • Alternative names

    • Beta chemokine exodus 3
    • Beta-chemokine exodus-3
    • C C chemokine ligand 19
    • C-C motif chemokine 19
    • CC chemokine ligand 19
    • CCL 19
    • CCL19
    • CCL19_HUMAN
    • Chemokine (C C motif) ligand 19
    • Chemokine (CC motif) ligand 19
    • Chemokine C C Motif Ligand 19
    • Chemokine CC Motif Ligand 19
    • CK beta 11
    • CK beta-11
    • CKb 11
    • CKb11
    • EBI 1 ligand chemokine
    • EBI1 ligand chemokine
    • ELC
    • Epstein-Barr virus-induced molecule 1 ligand chemokine
    • Exodus 3
    • Exodus3
    • Macrophage inflammatory protein 3 beta
    • MGC34433
    • MIP 3 beta
    • MIP 3B
    • MIP-3-beta
    • MIP-3b
    • MIP3 beta
    • MIP3B
    • OTTHUMP00000000531
    • SCYA 19
    • SCYA19
    • Small inducible cytokine A19
    • Small inducible cytokine subfamily A (Cys Cys) member 1
    • Small-inducible cytokine A19
    see all
  • Function

    May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Specifically binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes.
  • Tissue specificity

    Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab175155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up