Overview

  • Product name

    Anti-MIP-3 beta/CCL19 antibody
    See all MIP-3 beta/CCL19 primary antibodies
  • Description

    Rabbit polyclonal to MIP-3 beta/CCL19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MIP-3 beta/CCL19 aa 49-98.
    Sequence:

    LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS


    Database link: Q99731

  • Positive control

    • IHC-P: Human tonsil tissue.
  • General notes

     This product was previously labelled as Macrophage Inflammatory Protein 3 beta

     

Properties

Applications

Our Abpromise guarantee covers the use of ab221704 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Specifically binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes.
  • Tissue specificity

    Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta chemokine exodus 3 antibody
    • Beta-chemokine exodus-3 antibody
    • C C chemokine ligand 19 antibody
    • C-C motif chemokine 19 antibody
    • CC chemokine ligand 19 antibody
    • CCL 19 antibody
    • CCL19 antibody
    • CCL19_HUMAN antibody
    • Chemokine (C C motif) ligand 19 antibody
    • Chemokine (CC motif) ligand 19 antibody
    • Chemokine C C Motif Ligand 19 antibody
    • Chemokine CC Motif Ligand 19 antibody
    • CK beta 11 antibody
    • CK beta-11 antibody
    • CKb 11 antibody
    • CKb11 antibody
    • EBI 1 ligand chemokine antibody
    • EBI1 ligand chemokine antibody
    • ELC antibody
    • Epstein-Barr virus-induced molecule 1 ligand chemokine antibody
    • Exodus 3 antibody
    • Exodus3 antibody
    • Macrophage inflammatory protein 3 beta antibody
    • MGC34433 antibody
    • MIP 3 beta antibody
    • MIP 3B antibody
    • MIP-3-beta antibody
    • MIP-3b antibody
    • MIP3 beta antibody
    • MIP3B antibody
    • OTTHUMP00000000531 antibody
    • SCYA 19 antibody
    • SCYA19 antibody
    • Small inducible cytokine A19 antibody
    • Small inducible cytokine subfamily A (Cys Cys) member 1 antibody
    • Small-inducible cytokine A19 antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for MIP-3 beta/CCL19 using ab221704 at 1/500 dilution in immunohistochemical analysis.

References

ab221704 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221704.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up