Overview

  • Product name

  • Description

    Rabbit polyclonal to MIRO1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human MIRO1 aa 396-445 (internal sequence).
    Sequence:

    ASAVTVTRDKKIDLQKKQTQRNVFRCNVIGVKNCGKSGVLQALLGRNLMR


    Database link: Q8IXI2

  • Positive control

    • HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83779 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 71 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
  • Tissue specificity

    Ubiquitously expressed. Expressed at high level in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the mitochondrial Rho GTPase family.
    Contains 2 EF-hand domains.
    Contains 2 Miro domains.
  • Cellular localization

    Mitochondrion outer membrane. Colocalizes with MGARP and RHOT2 at the mitochondria.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHT 1 antibody
    • ARHT1 antibody
    • FLJ11040 antibody
    • FLJ12633 antibody
    • hMiro 1 antibody
    • hMiro-1 antibody
    • hMiro1 antibody
    • MIRO 1 antibody
    • MIRO-1 antibody
    • MIRO1 antibody
    • MIRO1_HUMAN antibody
    • mitochondrial Rho (MIRO) GTPase 1 antibody
    • Mitochondrial Rho 1 antibody
    • Mitochondrial Rho GTPase 1 antibody
    • Mitochondrial Rho1 antibody
    • Rac GTP binding protein like protein antibody
    • Rac-GTP-binding protein-like protein antibody
    • Ras homolog family member T1 antibody
    • Ras homolog gene family member T1 antibody
    • Rhot 1 antibody
    • RHOT1 antibody
    see all

Images

  • Anti-MIRO1 antibody (ab83779) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 71 kDa
    Observed band size: 65 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 35 kDa. We are unsure as to the identity of these extra bands.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

Answer

Gracias por ponerte en contacto con nosotros. En nuestro catálogo se encuentran disponibles dos anticuerpos contra la proteína Miro-1: ab55035: https://www.abcam.com/Rhot1-antibody-ab55035.html Que solo se ha testado en WB y sELISA, y reconoce la forma desnaturalizada de RHOT1 así como la proteína recombinante con una etiqueta GST. ab83779: https://www.abcam.com/Rhot1-antibody-ab83779.html Caracterizado únicamente mediante WB en su forma desnaturalizada. Ninguno de los dos anticuerpos se han usado en ensayos de immunoprecipitacion. Si estáis interesados en probarlos en dicha técnica, os podemos ofrecer un código de descuento valido para una futura compra completamente gratuita siempre que nos mandéis los resultados obtenidos de probar los anticuerpos en esta técnica aun no testada.   Este servicio de evaluación de anticuerpos, llamado Abreview, consiste en que nosotros emitimos un código de descuento antes de que hagáis el pedido de los anticuerpos, que se activa una vez nos mandéis los resultados. Este código es válido durante 4 meses para la adquisición de un anticuerpo primario completamente gratuito. Publicamos tanto los resultados positivos como los negativos en nuestra web, y se agradece mucho el envío de imágenes. Si queréis más información al respecto, os recomiendo que visitéis el sitio web: https://www.abcam.com/abreviews Respecto al envío de muestras gratuitas, me temo que no podemos mandaros ninguna. Tenemos un catálogo de más de 80.000 productos, por lo que nos resulta imposible guardar muestras de cada uno de ellos. Dado que no facilitamos este servicio, ofrecemos a los usuarios una garantía de 6 meses que garantiza que si el producto no funciona como se especifica en su datasheet, estaremos encantados de enviar un reemplazo, un reembolso del importe, o un vale que no caduca. Espero haberos ayudado. Si tenéis cualquier otra duda, no dudéis en contactarnos de nuevo.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up