Overview

  • Product name

    Anti-MIRO1 antibody [CL1095]
    See all MIRO1 primary antibodies
  • Description

    Mouse monoclonal [CL1095] to MIRO1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Cow
  • Immunogen

    Recombinant fragment corresponding to Human MIRO1 aa 53-142.
    Sequence:

    THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLIN ERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE


    Database link: Q8IXI2

  • Epitope

    Binds to an epitope located within the peptide sequence ERTDKDSRLP as determined by overlapping synthetic peptides.
  • Positive control

    • IHC-P: Human cerebral cortex, cerebellum, kidney, small intestine and testis tissues; Human liver cancer and colorectal cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab223750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
  • Tissue specificity

    Ubiquitously expressed. Expressed at high level in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the mitochondrial Rho GTPase family.
    Contains 2 EF-hand domains.
    Contains 2 Miro domains.
  • Cellular localization

    Mitochondrion outer membrane. Colocalizes with MGARP and RHOT2 at the mitochondria.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHT 1 antibody
    • ARHT1 antibody
    • FLJ11040 antibody
    • FLJ12633 antibody
    • hMiro 1 antibody
    • hMiro-1 antibody
    • hMiro1 antibody
    • MIRO 1 antibody
    • MIRO-1 antibody
    • MIRO1 antibody
    • MIRO1_HUMAN antibody
    • mitochondrial Rho (MIRO) GTPase 1 antibody
    • Mitochondrial Rho 1 antibody
    • Mitochondrial Rho GTPase 1 antibody
    • Mitochondrial Rho1 antibody
    • Rac GTP binding protein like protein antibody
    • Rac-GTP-binding protein-like protein antibody
    • Ras homolog family member T1 antibody
    • Ras homolog gene family member T1 antibody
    • Rhot 1 antibody
    • RHOT1 antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex tissue stained for MIRO1 using ab223750 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colorectal cancer tissue stained for MIRO1 using ab223750 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebellum tissue stained for MIRO1 using ab223750 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for MIRO1 using ab223750 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for MIRO1 using ab223750 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for MIRO1 using ab223750 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for MIRO1 using ab223750 at 1/200 dilution in immunohistochemical analysis.

References

ab223750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up