Overview

  • Product name

  • Description

    Rabbit polyclonal to MIRO2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MIRO2 aa 374-470.
    Sequence:

    RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVG ACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC


    Database link: Q8IXI1

  • Positive control

    • WB: HEK-293 cell lysate. IHC-P: Human small intestine tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224089 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 23,68 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100.

Target

  • Function

    Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution.
  • Tissue specificity

    Ubiquitously expressed. Highly expressed in heart, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the mitochondrial Rho GTPase family.
    Contains 2 EF-hand domains.
    Contains 2 Miro domains.
  • Cellular localization

    Mitochondrion outer membrane. Colocalizes with MGARP and RHOT2 at the mitochondria.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHT2 antibody
    • C16orf39 antibody
    • hMiro 2 antibody
    • hMiro-2 antibody
    • hMiro2 antibody
    • MIRO-2 antibody
    • MIRO2_HUMAN antibody
    • Mitochondrial Rho GTPase 2 antibody
    • Ras homolog gene family member T2 antibody
    • RASL antibody
    • RHOT2 antibody
    see all

Images

  • Anti-MIRO2 antibody (ab224089) at 1/100 dilution + HEK-293 (human epithelial cell line from embryonic kidney) cell lysate

    Predicted band size: 23,68 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for MIRO2 (green) using ab224089 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human small intestine tissue stained for MIRO2 using ab224089 at 1/50 dilution in immunohistochemical analysis.

References

ab224089 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224089.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up